DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult6b2

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001138862.1 Gene:Sult6b2 / 330440 MGIID:2685612 Length:290 Species:Mus musculus


Alignment Length:276 Identity:82/276 - (29%)
Similarity:139/276 - (50%) Gaps:33/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSID 106
            ||..|:.|....:||:::||||::|:.|..|::..:        .:..:.|.|| |||..:    
Mouse    25 ELLGSLDSFDAREDDIFLVSYPKSGTHWLAEVIERI--------PDAGITLTSP-IELGDI---- 76

  Fly   107 HHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKL 171
                  .||    :.::.:|:.|...:||.:.:||...:..:.:|:|..|||||..||.:||::.
Mouse    77 ------SKF----EELKRIPKRRAIPTHLNYEMLPVTVKQKQCKIIYIVRNPKDTAVSMFHYYRD 131

  Fly   172 LHGM--NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARF 234
            ...:  ...:..|::|||:|....||::.|||.:.:...|.|||||.||:|.||....:::...|
Mouse   132 NPNLPSTETWAAFLELFLKGDVVYGSWFDHVLSWEEHKNDKNVLFIFYEEMKKDFVKSLKKITAF 196

  Fly   235 LGVQSLLDVSTLQKLCDHLTFDKMRANKA-VNLEK-----LLPESSSKFIRNGKIGDWRNHMGNE 293
            ||:.  ::.|.:.|:....:|.:|::|.| .|.:.     .|....:...|.|.:|||.|:...:
Mouse   197 LGID--VNDSEMAKIARSTSFSEMKSNAAKENCDPNHVICALTSDRNLVFRKGVVGDWINYFTPK 259

  Fly   294 MSERFDEWTERHMRGS 309
            .:..|||.....||.|
Mouse   260 QNRVFDELFTEKMRNS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 78/263 (30%)
Sult6b2NP_001138862.1 Sulfotransfer_1 37..276 CDD:279075 78/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.