DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult1st1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_891986.1 Gene:sult1st1 / 323424 ZFINID:ZDB-GENE-030131-2144 Length:299 Species:Danio rerio


Alignment Length:286 Identity:88/286 - (30%)
Similarity:146/286 - (51%) Gaps:29/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLL--GHQLDYVAAEQDLRLRSPLIELSAL 102
            :.|..|.:::.....||:.:.:||:.|:||...::.||  |.........|.:.:|.|.:|  :.
Zfish    27 FTENWEKVKNFQARPDDILIATYPKAGTTWVSYILDLLYFGENAPEEHTSQPIYMRVPFLE--SC 89

  Fly   103 FSIDHHETVAQKFGNTVDLVRNL-PRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYY 166
            |.:         ..:..:|..|: ..||..::|||..|:|:.|.....|:||.|||.||..|||:
Zfish    90 FKV---------IASGTELADNMTTSPRLIKTHLPVQLIPKSFWEQNSRVVYVARNAKDNVVSYF 145

  Fly   167 HYFKLLHGMN------GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQD-DNVLFIKYEDMVKDL 224
            |:.:    ||      ||:..|:..|::|.:..|.::.||..:|::.|. ..:|::.|||:|:|.
Zfish   146 HFDR----MNIVEPDPGDWNTFLHRFMDGKSVFGPWYDHVNGYWEKKQTYSTLLYLFYEDLVEDT 206

  Fly   225 PSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKL--LPESSSKFIRNGKIGDWR 287
            ...|.|...|||:.:  .||..:|:...:.||.|:.||..|...|  :....|.|:|.||:|||:
Zfish   207 GREVDRLCSFLGLST--SVSDREKITKDVQFDAMKQNKMTNYSTLPVMDFKISPFMRKGKVGDWK 269

  Fly   288 NHMGNEMSERFDEWTERHMRGSGLNF 313
            ||.....:|:|||..:..|:.:.:.|
Zfish   270 NHFTVAQNEQFDEVYKEKMKNATVKF 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 85/266 (32%)
sult1st1NP_891986.1 Sulfotransfer_1 41..289 CDD:279075 84/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm6392
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.