DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult2b1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001034754.1 Gene:Sult2b1 / 292915 RGDID:1308882 Length:375 Species:Rattus norvegicus


Alignment Length:313 Identity:93/313 - (29%)
Similarity:144/313 - (46%) Gaps:44/313 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RELEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWA 70
            ::|:.:..|.....|||.....|.|           .|.|:..:  |..||:::|:||::|:.|.
  Rat    57 QKLQGEYFRYKGIPFPVGMYTPESL-----------SLAENTSN--VRDDDIFIVTYPKSGTNWM 108

  Fly    71 QEMVWLLGHQLD--YVAAEQDLRLRSPLIELS-ALFSIDHHETVAQKFGNTVDLVRNLPRPRFAR 132
            .|::.|:....|  ::.:| .:..|:|..|.: :.||:...                 |.||...
  Rat   109 IEIICLILKDGDPSWIRSE-PIWQRAPWCETTISAFSLPER-----------------PSPRLMC 155

  Fly   133 SHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMN--GDFEQFVDLFLEGHTPMGS 195
            ||||..|..:...:.|.:::|..|||:|:.||.|:|.|:...:.  |..|||:..||:|....||
  Rat   156 SHLPIELFTKAAFSSKAKVIYLGRNPRDVVVSLYYYSKIAVQLKDPGTPEQFLQNFLKGEVQFGS 220

  Fly   196 YWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRA 260
            ::.|:..:.:....:|.|||.||::.:||...|:....|||  ..|....|..:..|..|..|:|
  Rat   221 WFDHIKGWIRMRGRENFLFITYEELQQDLRGSVQLICEFLG--RPLGEEALSSVVAHSAFAAMKA 283

  Fly   261 NKAVNLEKLLPES-----SSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRG 308
            |...|. .|||.|     ...|:|.|..|||:||.....||.||:.....|.|
  Rat   284 NNMSNY-TLLPASLLDHRQGAFLRKGISGDWKNHFTVAQSETFDQVYREQMHG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 83/264 (31%)
Sult2b1NP_001034754.1 Sulfotransfer_1 92..337 CDD:366246 83/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.