DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and SULT1B1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005265733.1 Gene:SULT1B1 / 27284 HGNCID:17845 Length:301 Species:Homo sapiens


Alignment Length:315 Identity:89/315 - (28%)
Similarity:156/315 - (49%) Gaps:49/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VEVLPDQFIIPRKYVEL-------------GESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLG 78
            :||....:|: ||.::|             .|.|.......||:.:.:||::|:||..|::    
Human     4 MEVFSRNYIL-RKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEII---- 63

  Fly    79 HQLDYVAAEQDLRL--------RSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHL 135
               |.:..:.|:..        :.|::|:          |:.....:.::.:...|.||..::||
Human    64 ---DMILNDGDIEKCKRGFITEKVPMLEM----------TLPGLRTSGIEQLEKNPSPRIVKTHL 115

  Fly   136 PWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMN---GDFEQFVDLFLEGHTPMGSYW 197
            |..|||:.|.....:::|.|||.||:.||||| |.|::.:.   |.:|::::.||.|....||::
Human   116 PTDLLPKSFWENNCKMIYLARNAKDVSVSYYH-FDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWF 179

  Fly   198 RHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANK 262
            .||..:||:.::..:||:.||||.::....:::..|||  :..|:...|.::..|.:|:.|:.|.
Human   180 THVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFL--EKNLNDEILDRIIHHTSFEVMKDNP 242

  Fly   263 AVNLEKL----LPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
            .||...|    :..|.|.|:|.|..|||:|:.....:|:||...|..|..:.|.|
Human   243 LVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 79/269 (29%)
SULT1B1XP_005265733.1 Sulfotransfer_1 43..293 CDD:279075 79/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8578
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.