DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult2a1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_008757113.2 Gene:Sult2a1 / 24912 RGDID:621337 Length:287 Species:Rattus norvegicus


Alignment Length:268 Identity:71/268 - (26%)
Similarity:127/268 - (47%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VYQDDVWMVSYPRTGSTWAQEMVWLLGHQLD--YVAAEQDLRL--RSPLIELSALFSIDHHETVA 112
            |.::|:.:::||::|:.|..|:|.|:..:.|  ::   |.:.:  |||.||....:.|     :.
  Rat    31 VKEEDLILLAYPKSGTNWLIEIVCLIQTKGDPKWI---QSVTIWDRSPWIETDVGYDI-----LI 87

  Fly   113 QKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYF--KLLHGM 175
            :|.|           ||...||||..|..:...:.|.:::|..|||:|:.||.|:::  ..|...
  Rat    88 KKKG-----------PRLMTSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSGYYFWGNSTLVKK 141

  Fly   176 NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSL 240
            ......:|:.||:|:...||::.|:..:....:.||.|.:.||||.||....:::...|||.:  
  Rat   142 PDSLGTYVEWFLKGNVLYGSWFEHIRAWLSMREWDNFLLLYYEDMKKDTMGTIKKICDFLGKK-- 204

  Fly   241 LDVSTLQKLCDHLTFDKMRANKAVNLEKLLPES---SSKFIRNGKIGDWRNHM-----GNEMSER 297
            |:...|..:..:.:|..|:.|...|...|:.:|   ....:|.||...:..::     .||...:
  Rat   205 LEPDELDLVLKYSSFQVMKENDMSNYSLLMKKSIFTGIGLMRKGKEIVYHQNILKICFANESLRK 269

  Fly   298 FDEWTERH 305
            ..:.||.|
  Rat   270 CCKCTENH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 70/265 (26%)
Sult2a1XP_008757113.2 Sulfotransfer_1 33..249 CDD:395556 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.