DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult2a6

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_036827.3 Gene:Sult2a6 / 24902 RGDID:3727 Length:284 Species:Rattus norvegicus


Alignment Length:284 Identity:84/284 - (29%)
Similarity:139/284 - (48%) Gaps:32/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLD--YVAAEQDLRL--RS 94
            |.||::  .|........|.::|:.:::||::|:.|..|:|.|:..:.|  ::   |.:.:  ||
  Rat    15 FGIPKE--TLQNVCNKFVVKEEDLILLTYPKSGTNWLIEIVCLIQTKGDPKWI---QSVTIWDRS 74

  Fly    95 PLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPK 159
            |.||...     .::.:.:|.|           ||...||||..|..:...:.|.:::|..|||:
  Rat    75 PWIETDL-----GYDMLIKKKG-----------PRLITSHLPMHLFSKSLFSSKAKVIYLIRNPR 123

  Fly   160 DLCVS-YYHYFKLLHGMNGD-FEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVK 222
            |:.|| ||.:.|.......| ...:|:.||:|:.|.||::.|:..:....:.||.|.:.||||.|
  Rat   124 DVLVSGYYFWGKTTLAKKPDSLGTYVEWFLKGYVPYGSWFEHIRAWLSMRELDNFLLLYYEDMKK 188

  Fly   223 DLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVN---LEKLLPESSSKFIRNGKIG 284
            |....:::...|||.:  |:...|..:..:.:|..|:.|...|   :||.|......|:|||..|
  Rat   189 DTMGTIKKICDFLGKK--LEPDELDLVLKYSSFQVMKENNMSNYNLMEKELILPGFTFMRNGTTG 251

  Fly   285 DWRNHMGNEMSERFDEWTERHMRG 308
            ||:||.....:|.||:..:..|.|
  Rat   252 DWKNHFTVAQAEAFDKVFQEKMAG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 79/263 (30%)
Sult2a6NP_036827.3 Sulfotransfer_1 33..277 CDD:279075 79/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.