DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult1c1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_061221.2 Gene:Sult1c1 / 20888 MGIID:102928 Length:304 Species:Mus musculus


Alignment Length:274 Identity:83/274 - (30%)
Similarity:131/274 - (47%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRL--------RSPLIELSALFSIDHHETV 111
            ||:.:.:|.:.|:||.||:|       |.:..:.|::.        |.|.||.          |:
Mouse    47 DDLLIATYAKAGTTWTQEIV-------DMIQNDGDVQKCQRANTYDRHPFIEW----------TL 94

  Fly   112 AQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGM- 175
            .....:.:||...:|.||..::|||..:||..|.....:|:|.|||.||..|||| ||..::.| 
Mouse    95 PPPLNSGLDLANKMPSPRTLKTHLPVQMLPPSFWKENSKIIYVARNAKDCLVSYY-YFSRMNKML 158

  Fly   176 --NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQ 238
              .|...::::.|..|....||::.||..:|.......:|::.||||.:|....:::..:||  :
Mouse   159 PDPGTLGEYIETFKAGKVLWGSWYDHVKGWWDVKDKHRILYLFYEDMKEDPKREIKKIVKFL--E 221

  Fly   239 SLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGDWRNHMGNEMSERFD 299
            ..:....|.|:..|.:||.|:.|...|.    ..::..|.|.|:|.|..|||:|:.....||.||
Mouse   222 KDISEEVLNKIIHHTSFDVMKQNPMANYTTLPSSIMDHSISPFMRKGMPGDWKNYFTVAQSEDFD 286

  Fly   300 EWTERHMRGSGLNF 313
            |...:.|.||.:.|
Mouse   287 EDYRKKMAGSTITF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 81/269 (30%)
Sult1c1NP_061221.2 Sulfotransfer_1 46..297 CDD:279075 81/269 (30%)
Substrate binding. /evidence=ECO:0000250 115..117 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4511
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm44260
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.