DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult1e1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_075624.2 Gene:Sult1e1 / 20860 MGIID:98431 Length:295 Species:Mus musculus


Alignment Length:286 Identity:81/286 - (28%)
Similarity:152/286 - (53%) Gaps:20/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIEL 99
            ::.:::.:..|.:.......||:.:.:||::|:||..|:|:::..:.|....::|          
Mouse    19 LMDKRFTKYWEDVEMFLARPDDLVIATYPKSGTTWISEVVYMIYKEGDVEKCKED---------- 73

  Fly   100 SALFS-IDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCV 163
             |:|: |.:.|...:...|.:..::....||..::|||..|||..|.....:::|..||.||:.|
Mouse    74 -AIFNRIPYLECRNEDLINGIKQLKEKESPRIVKTHLPPKLLPASFWEKNCKMIYLCRNAKDVAV 137

  Fly   164 SYYHYFKLLHGMNG--DFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPS 226
            |||::..::.....  .|.:||:.|::|..|.||::.||..:|::|::..|||:.||||.:|:..
Mouse   138 SYYYFLLMITSYPNPKSFSEFVEKFMQGQVPYGSWYDHVKAWWEKSKNSRVLFMFYEDMKEDIRR 202

  Fly   227 VVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGDWR 287
            .|.:...||  :.......:.::..|.:|.:|:.|.:.|.    |:::.:..|.|:|.|.||||:
Mouse   203 EVVKLIEFL--ERKPSAELVDRIVQHTSFQEMKNNPSTNYTMMPEEMMNQKVSPFMRKGIIGDWK 265

  Fly   288 NHMGNEMSERFDEWTERHMRGSGLNF 313
            ||....:.|||||..::.|:...:.|
Mouse   266 NHFPEALRERFDEHYKQQMKDCTVKF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 79/261 (30%)
Sult1e1NP_075624.2 Sulfotransfer_1 38..288 CDD:366246 79/262 (30%)
Substrate binding. /evidence=ECO:0000269|PubMed:9360604, ECO:0007744|PDB:1AQU 106..108 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4511
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101388
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm44260
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.