DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and ssu-1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_507880.1 Gene:ssu-1 / 190959 WormBaseID:WBGene00013748 Length:412 Species:Caenorhabditis elegans


Alignment Length:288 Identity:91/288 - (31%)
Similarity:148/288 - (51%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PRKYVELGE------------SIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLL--GHQLDYVAAE 87
            |::.|..||            :.:|:...:.||.:.:||:.|:||.|.:...|  ||  ||.|.:
 Worm    57 PKQVVIDGEIWPPIFKPKNVRTAKSMQFGETDVVIATYPKCGTTWLQHITSQLIKGH--DYKAGK 119

  Fly    88 -QDLRLRSPLIE-LSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPR 150
             .:|.::||:|| :.|.|:                  .|:..||..::|.....:|:..:|   :
 Worm   120 GNELCVQSPMIERMGAAFA------------------DNIKGPRVLKTHFHHYNIPKYPDT---K 163

  Fly   151 IVYTARNPKDLCVSYYHY---FKLLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNV 212
            .:|..|||||...||:|:   ||:.:..||.::.|:|||..|....|.|:.|:|.:....:||||
 Worm   164 YIYCVRNPKDCLTSYFHHNRNFKIYNWANGTWDVFLDLFASGQLAFGDYFEHLLSWLPCLKDDNV 228

  Fly   213 LFIKYEDMVKDLPSVVRRCARFLGVQSLLDVST---LQKLCDHLTFDKMRANKAVNLEKLLPES- 273
            ||:|||||.:||.:.|.:..:|||.::...|..   |:::.|:.|.|.|:.::    ::..||| 
 Worm   229 LFLKYEDMFQDLENAVYKIGQFLGGEAAHRVENPEILREIVDNSTIDAMKKDQ----KRWFPESQ 289

  Fly   274 --SSKFIRNGKIGDWRNHMGNEMSERFD 299
              ..:|||.|...||:|:...|.|:|.|
 Worm   290 LHKVEFIRKGGSRDWKNYFTREQSDRID 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 86/258 (33%)
ssu-1NP_507880.1 Sulfotransfer_1 86..328 CDD:366246 86/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I3240
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I3188
Isobase 1 0.950 - 0 Normalized mean entropy S5749
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm14781
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.