DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and LOC100497516

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_031748831.1 Gene:LOC100497516 / 100497516 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:297 Identity:96/297 - (32%)
Similarity:151/297 - (50%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLR 91
            :|.:|    :|....:..::|.......||:.:.:||:.|:||.||:|.|:..:.|   |::..|
 Frog    23 IEGVP----LPSITCDAWDTIYGFQARGDDILIATYPKAGTTWMQEIVDLILQEGD---AQKGRR 80

  Fly    92 ----LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIV 152
                ::.|.|:|          ...:...:.|:|.:.:..||..::|||..|||..|.....:.|
 Frog    81 APCFIKVPFIDL----------VPPKPMPSGVELAQTMKSPRVLKTHLPINLLPPSFWEKNVKAV 135

  Fly   153 YTARNPKDLCVSYYHYFKLLHGM--NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFI 215
            |.|||.||..||||::.|:..|:  .|.:|.:...||.|..|.||::.||:.:.|......:|||
 Frog   136 YVARNAKDCMVSYYYFQKMNKGLPPPGTWENYFSTFLSGDVPWGSWFDHVIGWGKAMDKHQILFI 200

  Fly   216 KYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKL----LPESSSK 276
            .||||::|....:|:..:|||..  |....|:.:..|.:|..|:.|...|...|    :.::.|.
 Frog   201 FYEDMIEDPMREIRKVTKFLGKD--LSEEVLENIKYHTSFQAMKENPMANYTALPSAVMDQTISP 263

  Fly   277 FIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
            |:|.|.:||||||.....:..|||..::.|.||||||
 Frog   264 FMRKGTVGDWRNHFTVAQNIIFDEEYKKKMEGSGLNF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 87/264 (33%)
LOC100497516XP_031748831.1 Sulfotransfer_1 47..297 CDD:395556 87/264 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.