DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and LOC100487424

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002941350.1 Gene:LOC100487424 / 100487424 -ID:- Length:287 Species:Xenopus tropicalis


Alignment Length:278 Identity:82/278 - (29%)
Similarity:146/278 - (52%) Gaps:21/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMV-WLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHH 108
            :.|::......||.:.:||::|:||.||:| .:|....:.:........|.|.:||..|......
 Frog    22 QQIQTFQARPGDVLIATYPKSGTTWIQEIVDLILNEGNEEICRRSPTHERMPFVELLNLMKPGPE 86

  Fly   109 ETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKL-- 171
            |            |..:|.||..::|||..|:|..|...|.:::|.||||:|...|||::..:  
 Frog    87 E------------VNAMPSPRVLKTHLPVQLVPPFFWRYKCKVIYVARNPRDTVTSYYYFDHMVQ 139

  Fly   172 LHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLG 236
            :|...|::|:::..|::|....||::..|..||::....|:|::.:||:.::....:|:..|||.
 Frog   140 IHPAPGNWEEYLHRFMKGDVGWGSWYDQVKGFWEQKDQHNILYLFFEDIKQNPIHEIRKVMRFLD 204

  Fly   237 VQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGDWRNHMGNEMSER 297
            ..  |....|:|:....:||:|:.|...|.    ..::.:|..||:|.||:|||::|...:.:|.
 Frog   205 KD--LPEEVLEKIVHLSSFDQMKDNPMANFSAFPSDVVDQSHYKFMRKGKVGDWKSHFTVQQNEM 267

  Fly   298 FDEWTERHMRGSGLNFDY 315
            |:|..::.|.||.:.|:|
 Frog   268 FEEKYQQQMHGSAMKFNY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 78/261 (30%)
LOC100487424XP_002941350.1 Sulfotransfer_1 31..279 CDD:279075 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.