DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and XB5843062

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_031758733.1 Gene:XB5843062 / 100486282 XenbaseID:XB-GENE-5843063 Length:298 Species:Xenopus tropicalis


Alignment Length:280 Identity:87/280 - (31%)
Similarity:144/280 - (51%) Gaps:29/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLL---GHQLDYVAAEQDLRLRSPLIELSALFSID 106
            :|::...:...||::::||::|:.|.|:::.|:   ||:..  ..|.....|.|.||.: |..:|
 Frog    33 DSVQDFEIRDSDVFLITYPKSGTVWTQQILSLIVNEGHRNG--TEEIQNMSRVPWIEYN-LSKMD 94

  Fly   107 HHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKL 171
            :.               :.|.||...||||:..:|......:.:|:|.||||||:.|||||::|.
 Frog    95 YD---------------SRPSPRLFSSHLPYYFVPRDLRNKRGKIIYIARNPKDVAVSYYHFYKA 144

  Fly   172 LHGM--NGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARF 234
            :..:  ..|:|.|:|.:|.|.....|::.||..::...:|.|:||:.||:|.|||.|.||:..||
 Frog   145 IKKVKQKKDWETFLDDYLSGKVLSSSWFDHVKGWYTHQEDFNILFLTYEEMKKDLRSSVRQICRF 209

  Fly   235 LGVQSLLDVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGDWRNHMGNEMS 295
              |:..||...:..:.:..||..|:.:...|.    |..|....:..:|.|.:|||:|.|....:
 Frog   210 --VEKELDEREVDTIVEKATFQNMKQDPLANYTTVPEDTLDVKIATHLRKGTVGDWKNLMTVAQN 272

  Fly   296 ERFDEWTERHMRGSGLNFDY 315
            |:||:.....|.|..:||.:
 Frog   273 EKFDKIYSEKMIGVPINFTW 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 84/263 (32%)
XB5843062XP_031758733.1 Sulfotransfer_1 42..287 CDD:395556 84/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4088
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.