DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and LOC100486268

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_004913640.1 Gene:LOC100486268 / 100486268 -ID:- Length:288 Species:Xenopus tropicalis


Alignment Length:272 Identity:81/272 - (29%)
Similarity:136/272 - (50%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRL------RSPLIELSALFSIDHHETVA 112
            ::|:.:|:||::|:||.||::.|:     |...:.::..      |:|.:|     .|...:.:.
 Frog    35 EEDIVIVTYPKSGTTWMQEILTLI-----YSRGDAEIATTVPNWRRAPWLE-----HIYFKDFIT 89

  Fly   113 QKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMNG 177
            ::.|           ||...:|||..:|....:..|.:::|.||||||:.||||.:.|:...:..
 Frog    90 EENG-----------PRIITTHLPSDVLAPALQKSKAKVIYVARNPKDVAVSYYFFHKMARFLPN 143

  Fly   178 --DFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSL 240
              .|.:|::.||||....||::.||..:...||..:..:|.||||.|||...:::..:|||..  
 Frog   144 PQTFPEFLEQFLEGRVYYGSWFEHVKGWHSVSQTLDFFYITYEDMQKDLRRSIKKLCQFLGTP-- 206

  Fly   241 LDVSTLQKLCDHLTFDKMRANKAVNLE----KLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEW 301
            :....:.|:..|..|..|..|..||..    :::..|.|||:|.|.:|||:.|...|.:|.||:.
 Frog   207 MYSKEVDKVEHHCRFANMSQNSMVNYTLIPCEIMDHSQSKFMRKGMVGDWQQHFTEEHNEMFDKV 271

  Fly   302 TERHMRGSGLNF 313
            .:..:....|.|
 Frog   272 FQEKLSDCDLQF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 79/266 (30%)
LOC100486268XP_004913640.1 Sulfotransfer_1 35..280 CDD:395556 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4088
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.