DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult6b1l

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001120086.1 Gene:sult6b1l / 100145095 XenbaseID:XB-GENE-22064145 Length:286 Species:Xenopus tropicalis


Alignment Length:282 Identity:81/282 - (28%)
Similarity:138/282 - (48%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IRSLPVYQ---DDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHH 108
            :|||..:|   ||:.:||||::|:.|..|::    .||....|...:.:.||:            
 Frog    25 LRSLNNFQARDDDLLLVSYPKSGTHWLAEIL----RQLYNTKAPNKVSITSPI------------ 73

  Fly   109 ETVAQKFGNT--VDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKL 171
                 :||:.  ::.::::...|...:||.:.::|..|:..|.:.:|..|||||..||.:||:| 
 Frog    74 -----EFGDVGKLEELKSIAGRRIIPTHLSYDMIPSDFKDRKCKAIYIIRNPKDTAVSLFHYYK- 132

  Fly   172 LHGMN----GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCA 232
             ...|    ..:..|.::||.|....||::.|:|.:.:...:.:.||:.||.|.||||..||:.:
 Frog   133 -DNPNLPTIESWHAFYNMFLNGQVVCGSWFEHILGWEEHRNEMSTLFLYYEAMKKDLPKSVRKIS 196

  Fly   233 RFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPES-------SSKFI-RNGKIGDWRNH 289
            .|||:.  |..:.:.::|...:|.:|:.|  |..|...|.|       :.|.| |.|.:|||:.:
 Frog   197 SFLGIN--LSDNEISEICKKTSFGEMKTN--VERENSDPNSTVCALTTNKKLIFRKGTVGDWKQY 257

  Fly   290 MGNEMSERFDEWTERHMRGSGL 311
            ...:.:...||..:..|..|.|
 Frog   258 FTPKQNRLLDEEYKAKMDSSCL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 75/268 (28%)
sult6b1lNP_001120086.1 Sulfotransfer_1 35..275 CDD:279075 74/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.