DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and LOC100145082

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001120074.1 Gene:LOC100145082 / 100145082 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:316 Identity:102/316 - (32%)
Similarity:163/316 - (51%) Gaps:31/316 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQE 72
            :||.:.:..||  .|....:|.:|    :|....:..:||.:....:||:.:.::|:.|:||.||
 Frog     6 MEEVVKKMLNA--QVTMGHIEGVP----LPDSTCDAWDSIYNFQAREDDILVATFPKAGTTWMQE 64

  Fly    73 MVWLLGHQLDYVAAEQDLR----LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARS 133
            :|.|:..:.|   ||:..|    ::.|.|:|          ...:...:.|:|.:.:..||..::
 Frog    65 IVDLILQEGD---AEKGRRAPCFIKVPFIDL----------IPPKPMPSGVELAQTMKSPRVLKT 116

  Fly   134 HLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGM--NGDFEQFVDLFLEGHTPMGSY 196
            |||..|||..|.....:.||.|||.||..||||::.|:..|:  .|.:|.:...||.|..|.||:
 Frog   117 HLPINLLPPSFWEKNVKAVYVARNAKDCMVSYYYFQKINKGLPPPGTWENYFSAFLSGDVPWGSW 181

  Fly   197 WRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRAN 261
            :.||:.:||......:|||.||||::|....:|:..:||| :.|.| ..|:.:..|.:|..|:.|
 Frog   182 FDHVIGWWKAMDKHQILFIFYEDMIEDPMREIRKVMKFLG-KDLSD-EVLENIKHHTSFQTMKEN 244

  Fly   262 KAVNL----EKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
            ...|.    ..:..::.|.|:|.|.:|||:||.....:..|||..::.|.||||||
 Frog   245 PMTNFSVFPNVIFDQTISPFMRKGTVGDWKNHFTVAQNIIFDEEYKKKMEGSGLNF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 87/264 (33%)
LOC100145082NP_001120074.1 Sulfotransfer_1 46..297 CDD:279075 87/265 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4054
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4088
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.