DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult2a1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001120025.1 Gene:sult2a1 / 100144988 XenbaseID:XB-GENE-5872897 Length:287 Species:Xenopus tropicalis


Alignment Length:287 Identity:86/287 - (29%)
Similarity:147/287 - (51%) Gaps:29/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PRKYVE--LGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLD--YVAAEQDLRLRSPLI 97
            |..|.|  |........|..|||::|:||::|:.|..|::.|:....|  :|.:.. :.||||.|
 Frog    15 PGSYSEELLNSVENEFQVLDDDVYIVTYPKSGTNWLIEILSLIKKDADPNWVNSVV-IWLRSPWI 78

  Fly    98 ELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLC 162
            |              .|.|.  ..::::.|||...||||:.:.|:.|.|.|.:|:|..|||||:.
 Frog    79 E--------------TKEGQ--QQIKDVSRPRVLTSHLPFHIFPKSFFTSKAKIIYVMRNPKDIF 127

  Fly   163 VSYYHYFKLL-HGMNGD-FEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLP 225
            ||.:.:.|:: |..:.: |||:::.||:|:....|::.||..:.:...:.|...:.||::.:||.
 Frog   128 VSLFFFAKIICHYKDPESFEQYLEDFLQGNILYNSWFDHVKGWMQMKDNSNFFIVTYEELHQDLR 192

  Fly   226 SVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVN----LEKLLPESSSKFIRNGKIGDW 286
            ..:.|..:|:|.:  ||.:.:..:..|.:|:.|:.||..|    .::.:..:...|:|.|..|||
 Frog   193 GCITRICKFIGKE--LDDAKIDLIAKHSSFEVMKENKMSNYSLGTKEFIDHTKGSFMRKGMAGDW 255

  Fly   287 RNHMGNEMSERFDEWTERHMRGSGLNF 313
            :||.....||.||...:..|:...:.|
 Frog   256 KNHFTVAQSEHFDRVYQEKMKDLNVKF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 80/262 (31%)
sult2a1NP_001120025.1 Sulfotransfer_1 34..278 CDD:395556 80/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.