DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and XB5850668

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_012821496.1 Gene:XB5850668 / 100144919 XenbaseID:XB-GENE-5850669 Length:312 Species:Xenopus tropicalis


Alignment Length:273 Identity:89/273 - (32%)
Similarity:146/273 - (53%) Gaps:24/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYV-AAEQDLRLRSPLIELSALFSIDHHETVAQ 113
            |.|..|||:.|:||::|:||..|::.|:....|.. :.|.....|.|.||:.     |..||:.:
 Frog    56 LQVLDDDVFNVTYPKSGTTWMIEILSLIHTNGDPTWSKETPNWSRVPWIEIQ-----DSEETIKK 115

  Fly   114 KFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKL--LHGMN 176
                    :::  |.|:..||||..|..:.|...|.:::||||:|||:.||:||:.|:  .....
 Frog   116 --------IQD--RRRYLSSHLPRQLFCKSFTNSKAKVIYTARHPKDVAVSFYHFSKINKFFAYP 170

  Fly   177 GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLL 241
            ..|:.|:..||.|:.|.||::.||..:.:....||.||..|||:.|||...::|...|:|.:  |
 Frog   171 ESFDDFLKNFLSGNLPYGSWFDHVKGWLELVGTDNFLFNTYEDLQKDLRGTLKRICAFIGKE--L 233

  Fly   242 DVSTLQKLCDHLTFDKMRANKAVNL----EKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWT 302
            |.:.|..:.::::|..|:.|:..|.    ||::.::.::|:|.|..|||:||.....||.||:..
 Frog   234 DEAALDSVMENVSFHIMKDNRMANFSLVPEKIMDQTQNRFMRKGIAGDWKNHFTVAQSEYFDKVF 298

  Fly   303 ERHMRGSGLNFDY 315
            :..|...|:...:
 Frog   299 KEKMADIGVKLPW 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 86/261 (33%)
XB5850668XP_012821496.1 Sulfotransfer_1 60..306 CDD:366246 86/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4054
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4088
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.