DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and sult1b1

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001096254.1 Gene:sult1b1 / 100124815 XenbaseID:XB-GENE-6041573 Length:308 Species:Xenopus tropicalis


Alignment Length:290 Identity:89/290 - (30%)
Similarity:146/290 - (50%) Gaps:50/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDL--------RLRSPLIELSA 101
            |:.::.|   ||:.:.:||:.|:||.||:|       |.:...:||        .:|.|.:|:. 
 Frog    44 EAFQARP---DDLLIATYPKAGTTWMQEIV-------DSIMNAEDLIKVKRAPTHVRFPFLEIC- 97

  Fly   102 LFSIDHHETVAQKFGNT------VDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKD 160
                           |.      ||::...|.||..::||.:.|:|:.|.....:::|.|||.||
 Frog    98 ---------------NPPPLPCGVDILEQTPSPRIIKTHLQYELVPKSFWEHDCKVIYVARNAKD 147

  Fly   161 LCVSYYHYFKLLHGMN---GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVK 222
            ..||||| |.|::...   |.:|::|..||:|:.|.|.::.|||.:|:......:|::.||||.:
 Frog   148 NAVSYYH-FDLMNKTQPHPGTWEEYVGKFLKGNVPWGGWFDHVLGWWESRNKHQILYVFYEDMKE 211

  Fly   223 DLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKL----LPESSSKFIRNGKI 283
            |....:|:..||||..  |....|:.:|.:.:|..|:.|...|...:    ..:|.|:|:|.|::
 Frog   212 DPKCEIRKVMRFLGKD--LSEDLLENICQNTSFKAMKDNPMANYSAMPATVFDQSISQFMRKGEV 274

  Fly   284 GDWRNHMGNEMSERFDEWTERHMRGSGLNF 313
            .||:||...:.||.||...::.|.|:.|.|
 Frog   275 ADWKNHFTVQQSETFDAEYQKRMEGTDLKF 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 85/275 (31%)
sult1b1NP_001096254.1 Sulfotransfer_1 50..301 CDD:366246 86/279 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4054
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4088
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.