DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and Sult2a2

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_033312.2 Gene:Sult2a2 / 100043194 MGIID:107550 Length:194 Species:Mus musculus


Alignment Length:295 Identity:59/295 - (20%)
Similarity:97/295 - (32%) Gaps:128/295 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FPVQNCFVEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLD-- 82
            ||..:...|:|.|   |..|:|          |.::|:.:::||::|:.|..|:|.|:..:.|  
Mouse    13 FPAISYQREILED---IRNKFV----------VKEEDLLILTYPKSGTNWLNEIVCLIQTKGDPK 64

  Fly    83 YVAAEQDLRL--RSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFE 145
            ::   |.:.:  |||.||...     .:..:..|.|           ||...||||..|..:.|.
Mouse    65 WI---QTVPIWDRSPWIETEI-----GYPAIINKEG-----------PRLITSHLPIHLFSKSFF 110

  Fly   146 TVKPRIVYTARNPKDLCVSYYHYFKLLHGMN--GDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQ 208
            :.|.:.:|..|||:|:.||.|.::...:.:.  |....:.:.||:|                   
Mouse   111 SSKAKAIYLMRNPRDILVSGYFFWGNTNLVKNPGSLGTYFEWFLQG------------------- 156

  Fly   209 DDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPES 273
                                                                             
Mouse   157 ----------------------------------------------------------------- 156

  Fly   274 SSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRG 308
                  ||..|||:||.....:|.||:..:..|.|
Mouse   157 ------NGTTGDWKNHFTVAQAEAFDKVFQEKMAG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 50/260 (19%)
Sult2a2NP_033312.2 Sulfotransfer_1 34..187 CDD:279075 50/261 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4511
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5451
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.