DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St2 and LOC100038305

DIOPT Version :9

Sequence 1:NP_001287244.1 Gene:St2 / 41098 FlyBaseID:FBgn0037665 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001090879.1 Gene:LOC100038305 / 100038305 -ID:- Length:292 Species:Xenopus tropicalis


Alignment Length:275 Identity:68/275 - (24%)
Similarity:129/275 - (46%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SIRSLPVYQDDVWMVSYPRTGSTWA----QEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSID 106
            ::.||...:||:.:|:||:.|:.|.    .||::.:|.             :.|.|:.:.:    
 Frog    37 ALESLEAREDDLLIVTYPKCGTNWVIRILHEMLFFIGG-------------KEPSIDQAMI---- 84

  Fly   107 HHETVAQKFG--NTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYF 169
                   :||  ..|..::....||...:||.:..:|:.|...|.:.:...|||||..|||:|:.
 Frog    85 -------EFGKPEKVQALKEASSPRVFSTHLHYKDIPKSFLEKKVKTLLILRNPKDTAVSYFHFS 142

  Fly   170 K---LLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRC 231
            .   :|...: .::.|.:.::.|....||::.|...:.:...|:|::.:.:|||..|..:.::|.
 Frog   143 NNNPILPSYD-SWDLFFNDYINGKVCYGSFFDHNSAWGEHIDDENIMAMTFEDMKLDYATHLKRI 206

  Fly   232 ARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMGNEMSE 296
            :.|.|:.  |....|:::.:..||..|:.|......||    .:.|.|.|:||||::......|:
 Frog   207 SEFFGLS--LSEEQLKEIENKTTFKSMKENSEGTHGKL----GNTFFRKGEIGDWKSLFSEAQSK 265

  Fly   297 RFDEWTERHMRGSGL 311
            ..|...|:::.|:.|
 Frog   266 EVDAKFEQYLAGTKL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St2NP_001287244.1 Sulfotransfer_1 55..310 CDD:279075 65/263 (25%)
LOC100038305NP_001090879.1 Sulfotransfer_1 45..278 CDD:307022 64/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.