DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pum and PUM8

DIOPT Version :9

Sequence 1:NP_001262403.1 Gene:pum / 41094 FlyBaseID:FBgn0003165 Length:1533 Species:Drosophila melanogaster
Sequence 2:NP_173643.1 Gene:PUM8 / 838829 AraportID:AT1G22240 Length:515 Species:Arabidopsis thaliana


Alignment Length:324 Identity:100/324 - (30%)
Similarity:180/324 - (55%) Gaps:10/324 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1101 NQRYPNLQLRDLANHIVEFSQDQHGSRFIQQKLERATAAEKQMVFSEILAAAYSLMTDVFGNYVI 1165
            |:..|  ::.:...::...::||||.||:|...|..:|.:..::|||::.....||.|.||||::
plant   190 NESLP--KVSEFQGYVYFMAKDQHGCRFLQWIFEDGSALDALVIFSEVIPHVVELMMDPFGNYLM 252

  Fly  1166 QKFFEFGTPEQKNTLGMQV---KGHVLQLALQMYGCRVIQKALESISPEQQQEIVHE-LDGHVLK 1226
            ||..:....||:..:.:.|   .|.:::::|..||.||:|:.:|||...:|..:|.. |....|.
plant   253 QKLLDVCNEEQRTQIILMVTSEPGQLIRISLNAYGTRVVQRLVESIKTRKQISLVKSALRPGFLN 317

  Fly  1227 CVKDQNGNHVVQKCIECVDPVALQFIINAFKGQVYSLSTHPYGCRVIQRILEHCTAEQTTPILDE 1291
            .::|.|||||:|:|::|:.....:||..........::||.:||.|:|:.:.:.:..|...::.|
plant   318 LIRDLNGNHVIQRCLQCLSTEDNEFIFEDATKFCIDIATHRHGCCVLQKCIAYSSGLQREKLVTE 382

  Fly  1292 LHEHTEQLIQDQYGNYVIQHVLEHGKQEDKSILINSVRGKVLVLSQHKFASNVVEKCVTHATRGE 1356
            :..::..|.||.||||.:|.|||.......:.::..::|..:.||..||:|::||:|:||... .
plant   383 ISRNSLFLAQDPYGNYAVQFVLELRDFSAIAAMLAQLKGHYVELSMQKFSSHMVERCLTHCPE-S 446

  Fly  1357 RTGLIDEVCTFNDNALHVMMKDQYANYVVQKMIDVSEPTQLKKLMTKIRPHMAALRKYTYGKHI 1420
            |..::.|:.:...  ..::::|.|||:|:|..:.|::.:....|:..|||| :.||...|.|.|
plant   447 RPQIVRELISVPH--FDILIQDPYANFVIQAALAVTKGSLHATLVEVIRPH-SILRNNPYCKRI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumNP_001262403.1 Pumilio 1106..1424 CDD:153420 98/319 (31%)
PUM8NP_173643.1 Pumilio 201..510 CDD:153420 98/311 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5099
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000719
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.