DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and AAH1

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_014258.1 Gene:AAH1 / 855581 SGDID:S000005085 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:78/323 - (24%)
Similarity:132/323 - (40%) Gaps:58/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QFLKGLPKVELHAHLNGSLGIKSLCDLGERLYGTSCKDFLKLCAHFSRFEKDMDACFEKFAFVHE 67
            :||:.|||.|.|.||.|:|....|..|.:|      .|.:..    ..|.|.::...||:....:
Yeast     5 EFLQELPKCEHHLHLEGTLEPDLLFPLAKR------NDIILP----EGFPKSVEELNEKYKKFRD 59

  Fly    68 LTSTREGLRFATELAI--RDFAE-----------DNVQYVEMRTTPKANENYSRRDYLQIVIDAI 119
            |....:.....|.:.|  :||.:           ..:.:.|:...|:::.  ||...::.|....
Yeast    60 LQDFLDYYYIGTNVLISEQDFFDLAWAYFKKVHKQGLVHAEVFYDPQSHT--SRGISIETVTKGF 122

  Fly   120 -KAASETYPE--ITVKLLPSINRAEPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGRFSDF 181
             :|..:.:.|  ||.||:..:.|....:...:|:..|....:......||:|.:..|       |
Yeast   123 QRACDKAFSEFGITSKLIMCLLRHIEPEECLKTIEEATPFIKDGTISALGLDSAEKP-------F 180

  Fly   182 APIL-------AQARDKGLKLAIHCAEIENP----SEVKEMLHFGMSRCGHG--TFLTPEDIGQL 233
            .|.|       |.:.:|.|||..|..| |.|    |:..::|.  ::|..||  :....|.:.:|
Yeast   181 PPHLFVECYGKAASLNKDLKLTAHAGE-EGPAQFVSDALDLLQ--VTRIDHGINSQYDEELLDRL 242

  Fly   234 KQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFD-------TTLTKEF 289
            .:....:..|..||||...|.|:.|..|::.::.|.|..:.:||...|.       |.::|:|
Yeast   243 SRDQTMLTICPLSNVKLQVVQSVSELPLQKFLDRDVPFSLNSDDPAYFGGYILDVYTQVSKDF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 76/318 (24%)
AAH1NP_014258.1 aden_deam 10..338 CDD:273619 76/318 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346213
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.