DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and YJL070C

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_012465.3 Gene:YJL070C / 853375 SGDID:S000003606 Length:888 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:37/178 - (20%)
Similarity:66/178 - (37%) Gaps:56/178 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QYVEMRTTPKANENYSRRDYLQIVIDAIKAASETYPEITVKLLPSINRAEPVDVAE-ETVSLAVE 155
            :|....|.|...:|...|           ..||...:::    ||:.:.:.:.|.: :.:||..|
Yeast    14 EYQNSVTKPNETKNKEAR-----------VLSENDGDVS----PSVLKQKEISVDDMDMISLPTE 63

  Fly   156 LARAHPNLILGIDLSGNPGKGRFSDFAPILAQARDKGLKL------AIHCAEIENPSEVKEMLHF 214
            ..|   .::||               :|:.....|:..|:      :.|....|:.|.|......
Yeast    64 FDR---QMVLG---------------SPMFFDLEDEENKIDPLPSVSHHYGNGESDSFVSSYTPS 110

  Fly   215 GMSRCGHGT---FLTP-EDIGQLKQRNIA------IECCLTSNVKSGT 252
            .: :.|..|   |:.| |.:.|:::|.||      |     ||:|:.|
Yeast   111 NL-KTGEETKDLFINPFELVSQMRKRYIAASKQDGI-----SNIKNDT 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 37/178 (21%)
YJL070CNP_012465.3 Add 405..832 CDD:224729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.