DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and ampd2b

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_009302285.3 Gene:ampd2b / 571355 ZFINID:ZDB-GENE-070713-5 Length:830 Species:Danio rerio


Alignment Length:187 Identity:35/187 - (18%)
Similarity:67/187 - (35%) Gaps:64/187 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKGLPKVELHAHLNGSLGIKSLCD-----LGERLYGTSCKDFLKLCAHFSRFEKDMDAC---FEK 61
            |.|.| |..|.|::    :::..|     :.|.|:..|..            |.:|.:.   |.:
Zfish    58 LPGNP-VTKHGHID----LRTSMDGKYKEIAEELFSRSLA------------ESEMRSAPYEFPE 105

  Fly    62 FAFVHELTSTR--------EGLRFATELAIR--------DFAEDNVQYVEMRTTPKANENY---- 106
            .:.:.:|...|        :.::|..::.:|        |.|.|.....|...||  .|||    
Zfish   106 ESPIEQLEERRHRLERQISQDIKFEPDILLRAKQDFMKTDSATDLEYMKEQSQTP--IENYPERE 168

  Fly   107 --SRRDYLQIVIDAIKAASETYPEI------TVKLLPSINRAEPVDVAEETVSLAVE 155
              ..|:|.::.|...:.....:.::      .||.|         .:.|:.:||:::
Zfish   169 LIPEREYQRVTISGEEKCGVPFTDLLDAAKCVVKAL---------FIREKYISLSLQ 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 33/184 (18%)
ampd2bXP_009302285.3 AMPD 307..803 CDD:238644
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.