DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and ampd3a

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_009301872.1 Gene:ampd3a / 556578 ZFINID:ZDB-GENE-110407-2 Length:778 Species:Danio rerio


Alignment Length:440 Identity:90/440 - (20%)
Similarity:142/440 - (32%) Gaps:151/440 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKGLP--------KVELHAHLNGSLGIKSLCDLGERLYGTSC------KDFLKLCAH--FSRFEK 53
            |||:|        ||:.|.|....:..|.|.|..:..|.|..      |..|||...  |:....
Zfish   313 LKGVPHRDFYNVRKVDTHIHAAACMNQKHLLDFIQTTYKTDAERVVLEKAGLKLTLKQVFNNLNM 377

  Fly    54 D-----MDAC-----------FEKFAFVHELTSTRE-------------GLRFA---TELAIRDF 86
            |     :|:.           |:||...:......|             |..||   .|:| .:.
Zfish   378 DPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKADNYINGEYFARLIKEVA-HNL 441

  Fly    87 AEDNVQYVEMR-----TTPKANENYSR------------RDYLQI--VIDAIKAASETYPEITVK 132
            .|...|:.|.|     .:|:..|:.|.            |..:|:  :.|..::.         |
Zfish   442 EESKYQHAEPRLSIYGRSPEEWESLSHWFIQNKVYSPNMRWIIQVPRIYDIFRSR---------K 497

  Fly   133 LLPSINRAEPVDVAEETVSLAVELARAHP----------NLILGID---------------LSGN 172
            |:|  |.|:.:    |.|.|.:..|..:|          ..:.|.|               .|..
Zfish   498 LVP--NFAKML----ENVFLPLFEATVNPQKHKELHVFLKYVTGFDSVDDESKHSDHMFSYKSPK 556

  Fly   173 PGKGRFSDFAP-------------ILAQAR-DKGL---KLAIHCAEIENPSEVKEMLHFGMSRCG 220
            |.:....|..|             :|...| ::||   :...||.|..:.:.:.           
Zfish   557 PEQWTTDDNPPYSYYLFHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLV----------- 610

  Fly   221 HGTFLTPEDIG---QLKQRNIAIECCLTSNVKSGTVP----SLEEHHLKRIMEADAPKVIC---- 274
             ..|||.::|.   .||:..:.......:.|.....|    ||...:.|..:.....|.:|    
Zfish   611 -SAFLTADNISHGLNLKKSPVLQYLYYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLS 674

  Fly   275 TDDSGVFDTT---LTKEFLIAAETFGLTREQCIDLTLEAVHHSFASEQEQ 321
            |||...|..|   |.:|:.|||:.:.|:.....::...:|..|..|.:|:
Zfish   675 TDDPMQFHYTKEALMEEYAIAAQLWKLSTCDVCEIARNSVLQSGLSHEEK 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 87/437 (20%)
ampd3aXP_009301872.1 metallo-dependent_hydrolases 158..766 CDD:294200 90/440 (20%)
PLN03055 199..766 CDD:178613 90/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.