DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and ada

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_031749914.1 Gene:ada / 496434 XenbaseID:XB-GENE-950501 Length:365 Species:Xenopus tropicalis


Alignment Length:357 Identity:88/357 - (24%)
Similarity:150/357 - (42%) Gaps:66/357 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVELHAHLNGSLGIKSLCDLGER-------------LYGTSCKDFLKLCAHFSRFEKDMDACFEK 61
            |||||.||:||:..:::....::             |...|.|:.|.|....|:|...|.|    
 Frog    17 KVELHVHLDGSIKPETIIHFAKKRQIKLPADTVEGLLEHVSYKEPLSLTEFLSKFNHYMPA---- 77

  Fly    62 FAFVHELTSTREGL-RFATELAIRDFAEDNVQYVEMRTTPK--ANE------------NYSRRDY 111
                  :...||.: |.|.|. :...|::.|.|||:|.:|.  ||.            :.:..:.
 Frog    78 ------IAGDREAIKRIAYEF-VEMKAKEGVIYVEVRYSPHFLANSKVEPIPWGQKEGDITPDEV 135

  Fly   112 LQIVIDAIKAASETYPEITVKLLPSINRAEPVDVAEETVSLAVELARAHPN-LILGIDLSGN--- 172
            :.:|...::...:.: .|..:.:....|..|....|     .|||.:.:.| .::.|||:|:   
 Frog   136 VDLVNQGLRKGEKAF-NIKARSILCCMRHMPSWSTE-----VVELCKKYQNDTVVAIDLAGDESL 194

  Fly   173 -----PGKGRFSDFAPILAQARDKGLKLAIHCAEIENPSEVKEMLH-FGMSRCGHGTFLTPED-- 229
                 ||..:..:      :|...|:...:|..|:...|.|||.:. ....|.||| :.|.||  
 Frog   195 NCESYPGHRKAYE------EAVKCGIHRTVHAGEVGPSSVVKEAVEVLKAERIGHG-YHTTEDPN 252

  Fly   230 -IGQLKQRNIAIECCLTSNVKSGTV-PSLEEHHLKRIMEADAPKVICTDDSGVFDTTLTKEFLIA 292
             ..:|.::|:..|.|..|:..:|.. |...:|...:..:..|...:.|||..:|.:||..::.||
 Frog   253 LYKELLEKNMHFEVCPWSSYLTGACHPDFTKHPATQFRKDKANYSLNTDDPLIFGSTLDVDYSIA 317

  Fly   293 AETFGLTREQCIDLTLEAVHHSFASEQEQIQM 324
            |:..|.|.|:...:.:.|...||..|.|:.::
 Frog   318 AKHMGFTEEEFKRVNINAAKSSFLPESEKKEL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 88/357 (25%)
adaXP_031749914.1 ADA 17..353 CDD:238645 88/357 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.