DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and ada

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001002646.1 Gene:ada / 436919 ZFINID:ZDB-GENE-040718-393 Length:362 Species:Danio rerio


Alignment Length:360 Identity:90/360 - (25%)
Similarity:158/360 - (43%) Gaps:62/360 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKVELHAHLNGSLGIKSLCDLGERLYGTSC-----KDFLKLC-----AHFSRFEKDMDACFEKFA 63
            ||||||.||:|::.:|::.|:.:| .|.|.     ::..:||     |..:.|       ..||:
Zfish    13 PKVELHVHLDGAIRLKTVLDVAKR-RGISLPVSMEEELKELCTVNEPATLTEF-------LGKFS 69

  Fly    64 -FVHELTSTREGL-RFATELAIRDFAEDNVQYVEMRTTPK--ANE------------NYSRRDYL 112
             |:|.:...||.: |.|.|. :...|::.|.|||.|.:|.  ||:            :.:..|.:
Zfish    70 HFMHVIAGDREAIKRIAYEF-VETKAKEGVIYVEARYSPHFLANKGVEPLPWDQKPGDITPDDVV 133

  Fly   113 QIVIDAIKAASETYPEITVKLLPSINRAEPVDVAEETVSLAVELARAHPNLILGIDLSGN----- 172
            .:|....|...:.:......:|..: |..| :.:.|.|.|.   .:.|.:.::.|||:|:     
Zfish   134 DLVNQGFKEGEQAFKTKARSILCCM-RHMP-NWSMEVVELC---KKFHKDGVVAIDLAGDESMNC 193

  Fly   173 ---PG-KGRFSDFAPILAQARDKGLKLAIHCAEIENPSEVKEMLH-FGMSRCGHGTFLTPED--- 229
               || |..|.       :|....:...:|..|:...|.|:|.:. ....|.||| :.|.||   
Zfish   194 ESYPGHKKAFE-------EAVRSNVHRTVHAGEVGPASVVREAVEVLKAERIGHG-YHTLEDQNL 250

  Fly   230 IGQLKQRNIAIECC-LTSNVKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTTLTKEFLIAA 293
            ..||..:|:..|.| ::|.:.....|...:|.|....:..|...:.|||..:|::||..::.:..
Zfish   251 YKQLLHQNMHFEMCPVSSRLTGACEPDFTKHPLITFKKDKANYSLNTDDPTIFNSTLNSDYEVVQ 315

  Fly   294 ETFGLTREQCIDLTLEAVHHSFASEQEQIQMADRV 328
            :....|.|:...|.:.|....|..|:|:.::.:::
Zfish   316 KYMDFTEEEFKRLNINAAKSCFLPEKEKEKLLNQL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 90/357 (25%)
adaNP_001002646.1 ADA 11..350 CDD:238645 90/358 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.