DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Adgf-D

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_524345.2 Gene:Adgf-D / 41679 FlyBaseID:FBgn0038172 Length:502 Species:Drosophila melanogaster


Alignment Length:242 Identity:60/242 - (24%)
Similarity:96/242 - (39%) Gaps:51/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IRDFAEDNVQYVEMRT--TPKANENYSRRDYLQI------VIDAIKAASETYPEITVKLL-PSIN 138
            :.:..|||:.|.|:|.  :|..::|......|::      :::..||....:  |.||:: ...|
  Fly   225 LEELCEDNIIYAEIRASLSPLYDDNNRTLSTLEVANELERIVEEFKAKHHDF--IGVKVIYAKRN 287

  Fly   139 RAEPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGRFSDFAPILAQARDKGLKLAIHCAEIE 203
            ||...::... ::...:|..|.||.::|.||.|.                .|.|..|..:..::.
  Fly   288 RASEEEMLRR-ITTFKQLHHAKPNFVIGFDLIGQ----------------EDTGEPLNRYINQLS 335

  Fly   204 N-PSEVKEMLHFG-------------------MSRCGHGTFLT--PEDIGQLKQRNIAIECCLTS 246
            : ||......|.|                   ..|.||...|.  |:....:|:||||||....|
  Fly   336 DLPSTANYFFHAGETNWNGRTDWNMMDAILLNTKRIGHAFALPKHPQLWSTIKKRNIAIEVNPIS 400

  Fly   247 NVKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTT-LTKEFLIA 292
            |...|.|..|..|....::..:.|.||.:||.||:... |:.:|..|
  Fly   401 NQVLGFVWDLRNHPASFLIAENFPIVISSDDPGVWGAKGLSYDFYYA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 60/242 (25%)
Adgf-DNP_524345.2 A_deaminase_N 4..100 CDD:285627
adm_rel 27..498 CDD:273620 60/242 (25%)
ADGF 80..490 CDD:238646 60/242 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.