DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and ada2a

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001028889.2 Gene:ada2a / 373884 ZFINID:ZDB-GENE-030902-4 Length:503 Species:Danio rerio


Alignment Length:348 Identity:92/348 - (26%)
Similarity:147/348 - (42%) Gaps:48/348 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LCDLGERLYGTSCKD--FLKLCAHFS----RFEKDMDACFEKFAFV----HELTSTREGLRFATE 80
            |..|.|::..|:..|  |::....|:    |...:.|..:|:|..|    :.|.:.....:....
Zfish   158 LRSLREKIKNTTELDNSFIRNLTLFTEDPDRAYPNQDTVWERFEQVFLVAYGLVTYAPVFKDYLY 222

  Fly    81 LAIRDFAEDNVQYVEMRT-TPKANENYSR---RDY----LQIVIDAIKAASETYPE-ITVKLLPS 136
            ..:|.|.|||:.|||:|. .|:..|...|   :|:    .|.|::..|   :.:|: |..:::.:
Zfish   223 EGLRQFYEDNIMYVEIRALLPQTYELDGRLNDKDWSMAACQEVVNQFK---KHHPDFIGARVIFT 284

  Fly   137 INRAEPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGR----FSDFAPILAQARDKGLKLA- 196
            ::|......|.:||..|:.|.|..|:::.|.|..|....||    |.|   .|:...|||..|. 
Zfish   285 VHRKINATEAVKTVEEAMILRRNFPDVMAGFDFVGQEDLGRPLWYFKD---ALSLPEDKGFNLPY 346

  Fly   197 -IHCAEIEN-----PSEVKEMLHFGMSRCGHGTFLTPEDIGQLKQRN--IAIECCLTSNVKSGTV 253
             .|..|.::     ...:.:.|.|..:|.|||..|....:.:...|.  :.||.|..||.....|
Zfish   347 FFHAGETDSQGTDVDQNLMDALLFNTTRIGHGFALARHPVVKEMARKMYVPIEVCPISNQVLKLV 411

  Fly   254 PSLEEHHLKRIMEADAPKVICTDDSGVFD-TTLTKEFLIAAETFG---LTREQCIDLTLEAVHHS 314
            ..|.:|....:|....|.||.:||..||. |.|:.:|..|...||   .......:|.|.::.:|
Zfish   412 SDLRDHPAAVLMAEGHPLVISSDDPAVFGATALSHDFYEAFMGFGGMSFNLGTLKELALNSLRYS 476

  Fly   315 FASEQEQIQMADRVGNYADILVK 337
            ..|.|.:.:..|.      :|||
Zfish   477 TLSSQRKEEAIDA------LLVK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 88/336 (26%)
ada2aNP_001028889.2 A_deaminase_N <29..95 CDD:285627
adm_rel 30..502 CDD:273620 92/348 (26%)
ADGF 75..494 CDD:238646 92/348 (26%)
Substrate binding. /evidence=ECO:0000250 197..204 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.