DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Adgf-E

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_610977.1 Gene:Adgf-E / 36627 FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster


Alignment Length:366 Identity:83/366 - (22%)
Similarity:138/366 - (37%) Gaps:88/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QFLKGLPK-VELHAHLNGSLGIKSLCDLGERLYGTSCKDFLKLCAHFS-------RFEKD--MDA 57
            |.|:.:|| ..|.||.......:.:.::       :.:|.|.:|...:       ||.||  .|.
  Fly   123 QILRRMPKGAALKAHDTSMCSSRVVIEI-------TYRDNLWVCTTQNGCRVEEFRFAKDKPKDV 180

  Fly    58 CFE--KFAFVHELTSTR--EGLR--------------FATEL----------------------- 81
            .||  ::..:.:|...|  |.||              |.|..                       
  Fly   181 SFENGEWQPMEKLRELRGEENLRKYLQMRFSMYPLASFTTNAHAWRHMMGIFGLLDGLLQYAPVW 245

  Fly    82 ------AIRDFAEDNVQYVEMRTT-PKANENYS-------RRDYLQIVIDAIKAASETYPE-ITV 131
                  |:::|..|.|||:|:|:. |:.   ||       :|:.:||..|.::...:.:|. |..
  Fly   246 GDYYYNALKEFYADGVQYLEVRSVLPQL---YSLDGSRMPKRETVQIYKDTLERFKKEHPGFIDS 307

  Fly   132 KLL-PSINRAEPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGR-FSDFAPILAQARDKGLK 194
            ||: ..|...:| ::..|.:....||.:..|:.::|.||.|....|. .|:||..|.:..|. :.
  Fly   308 KLIYAPIRHVQP-ELVGEYIKECTELNKEFPSFVVGFDLVGQEDVGHPLSNFAAELLKLPDH-IH 370

  Fly   195 LAIHCAEI-----ENPSEVKEMLHFGMSRCGHGTFLT--PEDIGQLKQRNIAIECCLTSNVKSGT 252
            ...|..:.     .....:.:.:..|..|.|||..:|  |..:...|..|||:|.|..||.....
  Fly   371 FYFHAGQTNWYGSHVDQNLLDAIVLGTKRIGHGYTITKHPVLMRLAKYLNIALEVCPVSNQVLQL 435

  Fly   253 VPSLEEHHLKRIMEADAPKVICTDDSGVFDTT-LTKEFLIA 292
            ......|....::..:.|.||.:...|.:... |:.:|.:|
  Fly   436 GSDYRSHPAATLIAENVPMVIASGSPGFWRAAPLSHDFYMA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 81/361 (22%)
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627 1/1 (100%)
adm_rel 52..527 CDD:273620 83/366 (23%)
ADGF 105..519 CDD:238646 83/366 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469146
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11409
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.