DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and ampd3b

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_956142.1 Gene:ampd3b / 333997 ZFINID:ZDB-GENE-030131-5929 Length:779 Species:Danio rerio


Alignment Length:150 Identity:34/150 - (22%)
Similarity:58/150 - (38%) Gaps:29/150 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 RDKGLKLAI---HCAEIENPSEVKEMLHFGMSRCGHGTFLTPEDIG---QLKQRNIAIECCLTSN 247
            :::||...:   ||.|..:.:.:.            ..|||.::|.   .||:..:.......:.
Zfish   586 KERGLNTFLFRPHCGEAGSITHLV------------SAFLTADNISHGLNLKKSPVLQYLYYLAQ 638

  Fly   248 VKSGTVP----SLEEHHLKRIMEADAPKVIC----TDDSGVFDTT---LTKEFLIAAETFGLTRE 301
            |.....|    ||...:.|..:.....|.:|    |||...|..|   |.:|:.|||:.:.|:..
Zfish   639 VPIAMSPLSNNSLFLEYSKNPLREFLQKGLCVSLSTDDPLQFHYTKEALMEEYAIAAQLWKLSTC 703

  Fly   302 QCIDLTLEAVHHSFASEQEQ 321
            ...::...:|..|..|.||:
Zfish   704 DTCEIARNSVLQSGLSHQEK 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 34/149 (23%)
ampd3bNP_956142.1 PLN03055 157..765 CDD:178613 34/149 (23%)
metallo-dependent_hydrolases 157..765 CDD:294200 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.