DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Ampd3

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_113732.2 Gene:Ampd3 / 25095 RGDID:2111 Length:801 Species:Rattus norvegicus


Alignment Length:439 Identity:81/439 - (18%)
Similarity:137/439 - (31%) Gaps:139/439 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQF--LKGLP--------KVELHAHLNGSLGIKSLC-----------------DLGERLYGTSC 38
            |.:|  ||..|        ||:.|.|....:..|.|.                 .||.::.....
  Rat   328 MSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKYTYQTEPDRTVAEKLGRKITLRQV 392

  Fly    39 KDFLKLCAHFSRFEKDMDAC-----------FEKF---------AFVHELTSTREG-------LR 76
            .|.|    |...::..:|:.           |:||         :.:.:|....|.       .|
  Rat   393 FDSL----HMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFAR 453

  Fly    77 FATELAIRDFAEDNVQYVEMR-----TTPKANENYSR------------RDYLQI--VIDAIKAA 122
            ...|:| |:..:...||.|.|     .:||...:.:|            |..:|:  :.|..::.
  Rat   454 MVKEVA-RELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSK 517

  Fly   123 SETYPEITVKLLPSINRAEPVDVAEETVSLAVELARAHP----------NLILGIDLSGNPGK-- 175
                     |||||..:      ..|.:.|.:..|..:|          ..:.|.|...:..|  
  Rat   518 ---------KLLPSFGK------MLENIFLPLFQATINPQDHRELHLFLKYVTGFDSVDDESKHS 567

  Fly   176 -GRFSDFAP-------------------------ILAQ-ARDKGLKLAI---HCAEIENPSEVKE 210
             ..|||.:|                         :|.. .|::||...:   ||.|..:.:.:..
  Rat   568 DHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVS 632

  Fly   211 MLHFGMSRCGHGTFLTPEDIGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICT 275
            .. .......||..|....:.|.......|...::....:.......::.|:..:.......:.|
  Rat   633 AF-LTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLST 696

  Fly   276 DDSGVFDTT---LTKEFLIAAETFGLTREQCIDLTLEAVHHSFASEQEQ 321
            ||...|..|   |.:|:.|||:.:.|:.....::...:|..|..|.||:
  Rat   697 DDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEK 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 77/430 (18%)
Ampd3NP_113732.2 AMP_deaminase 181..787 CDD:273618 81/439 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.