DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Ampd1

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_038957689.1 Gene:Ampd1 / 25028 RGDID:2109 Length:772 Species:Rattus norvegicus


Alignment Length:433 Identity:89/433 - (20%)
Similarity:153/433 - (35%) Gaps:140/433 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVELHAHLNGSLGIKSL---------CDLGERLYGTSCKD------FLKLCAH------------ 47
            ||:.|.|....:..|.|         .|....:|.|..|:      |.:|..|            
  Rat   324 KVDTHIHAAACMNQKHLLRFIKKSYHIDADRVVYSTKEKNLTLKELFAQLNMHPYDLTVDSLDVH 388

  Fly    48 -----FSRFEKDMD-----ACFEKFAFVHELTSTREGLRFATELAIRDFAEDNV----QYVEMRT 98
                 |.||:|..|     ...|......:..:...|..|||  .|::...|.|    |:.|.|.
  Rat   389 AGRQTFQRFDKFNDKYNPVGASELRDLYLKTDNYINGEYFAT--IIKEVGADLVDAKYQHAEPRL 451

  Fly    99 T--PKANENYSR--------RDY-------LQI--VIDAIKAASETYPEITVKLLPSINRAEPVD 144
            :  .::.:.:|:        |.|       :|:  :.|..:  |:.:.....|:|.:|.    :.
  Rat   452 SIYGRSPDEWSKLSSWFVGNRIYCPNMTWMIQVPRIYDVFR--SKNFLPHFGKMLENIF----LP 510

  Fly   145 VAEETVSLAVELARAHPNL------ILGID------------------------LSGNPGKGRFS 179
            |.|.|::     .:.||:|      |.|.|                        :..||....::
  Rat   511 VFEATIN-----PQTHPDLSVFLKHITGFDSVDDESKHSGHMFSSKSPKPEEWTMENNPSYTYYA 570

  Fly   180 --DFAPIL---AQARDKGLKLAI---HCAEIENPSEVKEMLHFGMS-RCGHGTFLTPEDIGQ--- 232
              .:|.|:   ...:::|:...:   ||.|....:.:  |..|.:: ...||..|....:.|   
  Rat   571 YYMYANIMVLNCLRKERGMNTFLFRPHCGEAGALTHL--MTAFMIADNISHGLNLKKSPVLQYLF 633

  Fly   233 -LKQRNIAIECCLTSN------VKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTT---LTK 287
             |.|..||:. .|::|      .|:..:..|:    |.:|.:     :.|||...|..|   |.:
  Rat   634 FLAQIPIAMS-PLSNNSLFLEYAKNPFLDFLQ----KGLMIS-----LSTDDPMQFHFTKEPLME 688

  Fly   288 EFLIAAETFGLTREQCIDLTLEAVHHSFASEQEQIQMADRVGN 330
            |:.|||:.|.|:.....::...:|.....|.:|:   |..:||
  Rat   689 EYAIAAQVFKLSTCDMCEVARNSVLQCGISHEEK---AKFLGN 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 87/428 (20%)
Ampd1XP_038957689.1 AMPD 265..761 CDD:238644 89/433 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.