DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Ada

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_569083.1 Gene:Ada / 24165 RGDID:2031 Length:352 Species:Rattus norvegicus


Alignment Length:364 Identity:80/364 - (21%)
Similarity:150/364 - (41%) Gaps:70/364 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKVELHAHLNGSL----------------------GIKSLCDLGERLYGTSCKDFLKLCAHFSRF 51
            ||||||.||:|::                      |::::..:.:.|   |..|||      ::|
  Rat    10 PKVELHVHLDGAIKPETILYYGKKRGIDLPADTVEGLRNIIGMDKPL---SLPDFL------AKF 65

  Fly    52 EKDMDACFEKFAFVHELTSTREGL-RFATELAIRDFAEDNVQYVEMRTTP--------------K 101
            :..|.|          :...||.: |.|.|. :...|::.|.|||:|.:|              :
  Rat    66 DYYMPA----------IAGCREAIKRIAYEF-VEMKAKEGVVYVEVRYSPHLLANSKVDPIPWNQ 119

  Fly   102 ANENYSRRDYLQIVIDAIKAASETYPEITVKLLPSINRAEPVDVAEETVSLAVELARAHPNLILG 166
            |..:.:..:.:.:|...::...:.: .|.|:.:....|.:| ..:.|.:.|.   .:.|...::.
  Rat   120 AEGDLTPDEVVDLVNQGLQEGEQAF-GIKVRSILCCMRHQP-SWSPEVLELC---KKYHQKTVVA 179

  Fly   167 IDLSGN---PGKGRFSDFAPILAQARDKGLKLAIHCAEIENPSEVKEMLH-FGMSRCGHGTFLTP 227
            :||:|:   .|...|.........|...|:...:|..|:.:...|:|.:. ....|.||| :.|.
  Rat   180 MDLAGDETIEGSSLFPGHVEAYEGAVKDGIHRTVHAGEVGSAEVVREAVDILKTERVGHG-YHTI 243

  Fly   228 ED---IGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTTLTKEF 289
            ||   ..:|.:.|:..|.|..|:..:|.......|.:.|..:..|...:.:||..:|.:|:..::
  Rat   244 EDEALYNRLLKENMHFEVCPWSSYLTGAWNPKTTHAVVRFKDDQANYSLNSDDPLIFKSTVDTDY 308

  Fly   290 LIAAETFGLTREQCIDLTLEAVHHSFASEQEQIQMADRV 328
            .:..:..|.|.|:...|.:.|...||..|.|:.::.:|:
  Rat   309 QMVKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLERL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 79/361 (22%)
AdaNP_569083.1 metallo-dependent_hydrolases 9..347 CDD:294200 80/364 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.