DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Ampd1

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001028475.2 Gene:Ampd1 / 229665 MGIID:88015 Length:745 Species:Mus musculus


Alignment Length:432 Identity:88/432 - (20%)
Similarity:151/432 - (34%) Gaps:138/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVELHAHLNGSLGIKSL---------CDLGERLYGTSCKD------FLKLCAH------------ 47
            ||:.|.|....:..|.|         .|....:|.|..|.      |.||..|            
Mouse   297 KVDTHIHAAACMNQKHLLRFIKKSYHIDADRVVYSTKEKSLTLKELFAKLNMHPYDLTVDSLDVH 361

  Fly    48 -----FSRFEKDMD-----ACFEKFAFVHELTSTREGLRFAT---ELAIRDFAEDNVQYVEMRTT 99
                 |.||:|..|     ...|......:..:...|..|||   |:. .|..|...|:.|.|.:
Mouse   362 AGRQTFQRFDKFNDKYNPVGASELRDLYLKTDNYINGEYFATIIKEVG-ADLVEAKYQHAEPRLS 425

  Fly   100 --PKANENYSR--------RDY-------LQI--VIDAIKAASETYPEITVKLLPSINRAEPVDV 145
              .::.:.:::        |.|       :|:  :.|..:  |:.:.....|:|.:|.    :.|
Mouse   426 IYGRSPDEWNKLSSWFVCNRIYCPNMTWMIQVPRIYDVFR--SKNFLPHFGKMLENIF----LPV 484

  Fly   146 AEETVSLAVELARAHPNL------ILGID------------------------LSGNPGKG---- 176
            .|.|::     .:|||:|      |.|.|                        :..||...    
Mouse   485 FEATIN-----PQAHPDLSVFLKHITGFDSVDDESKHSGHMFSSKSPKPEEWTMENNPSYTYYAY 544

  Fly   177 -RFSDFAPILAQARDKGLKLAI---HCAEIENPSEVKEMLHFGMS-RCGHGTFLTPEDIGQ---- 232
             .:::...:.:..:::|:...:   ||.|....:.:  |..|.:: ...||..|....:.|    
Mouse   545 YMYANITVLNSLRKERGMNTFLFRPHCGEAGALTHL--MTAFMIADNISHGLNLKKSPVLQYLFF 607

  Fly   233 LKQRNIAIECCLTSN------VKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTT---LTKE 288
            |.|..||:. .|::|      .|:..:..|:    |.:|.:     :.|||...|..|   |.:|
Mouse   608 LAQIPIAMS-PLSNNSLFLEYAKNPFLDFLQ----KGLMIS-----LSTDDPMQFHFTKEPLMEE 662

  Fly   289 FLIAAETFGLTREQCIDLTLEAVHHSFASEQEQIQMADRVGN 330
            :.|||:.|.|:.....::...:|.....|.:|:   |..:||
Mouse   663 YAIAAQVFKLSTCDMCEVARNSVLQCGISHEEK---AKFLGN 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 86/427 (20%)
Ampd1NP_001028475.2 PLN03055 129..740 CDD:178613 88/432 (20%)
AMPD 238..734 CDD:238644 88/432 (20%)
Substrate binding. /evidence=ECO:0000250 372..377 2/4 (50%)
Substrate binding. /evidence=ECO:0000250 648..651 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.