DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Ampd3

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001359370.1 Gene:Ampd3 / 11717 MGIID:1096344 Length:775 Species:Mus musculus


Alignment Length:439 Identity:80/439 - (18%)
Similarity:137/439 - (31%) Gaps:139/439 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQF--LKGLP--------KVELHAHLNGSLGIKSLC-----------------DLGERLYGTSC 38
            |.:|  ||..|        ||:.|.|....:..|.|.                 .||.::.....
Mouse   302 MSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTVAEKLGRKITLRQV 366

  Fly    39 KDFLKLCAHFSRFEKDMDAC-----------FEKF---------AFVHELTSTREG-------LR 76
            .|.|    |...::..:|:.           |:||         :.:.:|....|.       .|
Mouse   367 FDSL----HMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFAR 427

  Fly    77 FATELAIRDFAEDNVQYVEMR-----TTPKANENYSR------------RDYLQI--VIDAIKAA 122
            ...|:| |:..:...||.|.|     .:||...:.:|            |..:|:  :.|..::.
Mouse   428 MVKEVA-RELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSK 491

  Fly   123 SETYPEITVKLLPSINRAEPVDVAEETVSLAVELARAHP----------NLILGIDLSGNPGK-- 175
                     ||||:..:      ..|.:.|.:..|..:|          ..:.|.|...:..|  
Mouse   492 ---------KLLPNFGK------MLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHS 541

  Fly   176 -GRFSDFAP-------------------------ILAQ-ARDKGLKLAI---HCAEIENPSEVKE 210
             ..|||.:|                         :|.. .|::||...:   ||.|..:.:.:..
Mouse   542 DHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVS 606

  Fly   211 MLHFGMSRCGHGTFLTPEDIGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICT 275
            .. .......||..|....:.|.......|...::....:.......::.|:..:.......:.|
Mouse   607 AF-LTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLST 670

  Fly   276 DDSGVFDTT---LTKEFLIAAETFGLTREQCIDLTLEAVHHSFASEQEQ 321
            ||...|..|   |.:|:.|||:.:.|:.....::...:|..|..|.||:
Mouse   671 DDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEK 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 76/430 (18%)
Ampd3NP_001359370.1 AMP_deaminase 155..761 CDD:273618 80/439 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.