DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and ADA

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_000013.2 Gene:ADA / 100 HGNCID:186 Length:363 Species:Homo sapiens


Alignment Length:356 Identity:87/356 - (24%)
Similarity:145/356 - (40%) Gaps:58/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKVELHAHLNGSLGIKSLCDLGER----LYGTSCKDFLKLCA---------HFSRFEKDMDACFE 60
            ||||||.||:||:..:::...|.|    |...:.:..|.:..         ..::|:..|.|   
Human    10 PKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPA--- 71

  Fly    61 KFAFVHELTSTREGL-RFATELAIRDFAEDNVQYVEMRTTPKANENYSRRDYLQIVIDAI---KA 121
                   :...||.: |.|.|. :...|::.|.|||:|.:|....|..        ::.|   :|
Human    72 -------IAGCREAIKRIAYEF-VEMKAKEGVVYVEVRYSPHLLANSK--------VEPIPWNQA 120

  Fly   122 ASETYPEITVKLLPSINRAEPVDVAEETVSL-------------AVELARAH-PNLILGIDLSGN 172
            ..:..|:..|.|:....:....|...:..|:             .|||.:.: ...::.|||:|:
Human   121 EGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGD 185

  Fly   173 ---PGKGRFSDFAPILAQARDKGLKLAIHCAEIENPSEVKEMLH-FGMSRCGHGTFLTPED---I 230
               ||............:|...|:...:|..|:.:...|||.:. ....|.||| :.|.||   .
Human   186 ETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHG-YHTLEDQALY 249

  Fly   231 GQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTTLTKEFLIAAET 295
            .:|:|.|:..|.|..|:..:|......||.:.|:....|...:.|||..:|.:||..::.:....
Human   250 NRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRD 314

  Fly   296 FGLTREQCIDLTLEAVHHSFASEQEQIQMAD 326
            .|.|.|:...|.:.|...||..|.|:.::.|
Human   315 MGFTEEEFKRLNINAAKSSFLPEDEKRELLD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 87/356 (24%)
ADANP_000013.2 metallo-dependent_hydrolases 9..347 CDD:320877 87/356 (24%)
Required for binding to DDP4. /evidence=ECO:0000269|PubMed:15016824 126..143 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R23
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.