Sequence 1: | NP_649865.1 | Gene: | beag / 41091 | FlyBaseID: | FBgn0037660 | Length: | 557 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080740.2 | Gene: | Wdr55 / 67936 | MGIID: | 1915186 | Length: | 388 | Species: | Mus musculus |
Alignment Length: | 238 | Identity: | 50/238 - (21%) |
---|---|---|---|
Similarity: | 89/238 - (37%) | Gaps: | 68/238 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 KQEDVKLQELSEKYRDRARERRDGANPDYVNVSTPGHGSSTNAYR--AVAPDMKSGI-----DAQ 147
Fly 148 ERRRRIIQESKFLGGDIQHTHLVKGLDYALLQKVRSELHSKEAEEEEIAAAVAREKLAEAAAAAE 212
Fly 213 QLEAERRESEDINA-INGALARNIYNLVQA---------RRSKEVPRNELFAPGRMAYVIDL--- 264
Fly 265 -----------DDELGESDIPTTLKRSKFEVPVSQEDVATLTT 296 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
beag | NP_649865.1 | RED_N | 87..315 | CDD:285099 | 50/238 (21%) |
RED_C | 434..539 | CDD:285098 | |||
Wdr55 | NP_080740.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | 4/25 (16%) | |
WD 1 | 37..76 | 8/44 (18%) | |||
WD40 | <43..338 | CDD:225201 | 44/202 (22%) | ||
WD40 repeat | 43..82 | CDD:293791 | 9/44 (20%) | ||
WD 2 | 83..122 | 10/53 (19%) | |||
WD40 | 84..331 | CDD:295369 | 35/155 (23%) | ||
WD40 repeat | 89..126 | CDD:293791 | 11/40 (28%) | ||
WD 3 | 126..164 | 9/37 (24%) | |||
WD40 repeat | 131..166 | CDD:293791 | 8/36 (22%) | ||
WD 4 | 167..206 | 10/43 (23%) | |||
WD40 repeat | 173..207 | CDD:293791 | 9/38 (24%) | ||
WD 5 | 209..248 | 2/8 (25%) | |||
WD40 repeat | 214..251 | CDD:293791 | 2/3 (67%) | ||
WD 6 | 251..290 | ||||
WD40 repeat | 259..296 | CDD:293791 | |||
WD 7 | 293..333 | ||||
WD40 repeat | 303..323 | CDD:293791 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 364..388 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1814 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |