powered by:
Protein Alignment beag and wdr55
DIOPT Version :9
Sequence 1: | NP_649865.1 |
Gene: | beag / 41091 |
FlyBaseID: | FBgn0037660 |
Length: | 557 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001003871.1 |
Gene: | wdr55 / 445394 |
ZFINID: | ZDB-GENE-040924-7 |
Length: | 386 |
Species: | Danio rerio |
Alignment Length: | 31 |
Identity: | 12/31 - (38%) |
Similarity: | 16/31 - (51%) |
Gaps: | 9/31 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 NDLRRKKKNFYAALKKQEDVKLQELSEKYRD 105
||.||:|| :|.:|:.||.|..|
Zfish 330 NDYRRRKK---------KDRRLKALSNKAFD 351
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1814 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.