DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beag and wdr55

DIOPT Version :9

Sequence 1:NP_649865.1 Gene:beag / 41091 FlyBaseID:FBgn0037660 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001003871.1 Gene:wdr55 / 445394 ZFINID:ZDB-GENE-040924-7 Length:386 Species:Danio rerio


Alignment Length:31 Identity:12/31 - (38%)
Similarity:16/31 - (51%) Gaps:9/31 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NDLRRKKKNFYAALKKQEDVKLQELSEKYRD 105
            ||.||:||         :|.:|:.||.|..|
Zfish   330 NDYRRRKK---------KDRRLKALSNKAFD 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beagNP_649865.1 RED_N 87..315 CDD:285099 6/19 (32%)
RED_C 434..539 CDD:285098
wdr55NP_001003871.1 WD 1 33..72
WD40 <35..329 CDD:225201
WD40 38..320 CDD:295369
WD40 repeat 39..76 CDD:293791
WD 2 79..118
WD40 repeat 81..120 CDD:293791
WD 3 122..160
WD40 repeat 128..162 CDD:293791
WD 4 163..202
WD40 repeat 168..202 CDD:293791
WD 5 205..244
WD40 repeat 210..247 CDD:293791
WD 6 247..286
WD40 repeat 253..274 CDD:293791
WD 7 290..329
WD40 repeat 299..319 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1814
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.