Sequence 1: | NP_649865.1 | Gene: | beag / 41091 | FlyBaseID: | FBgn0037660 | Length: | 557 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001342873.1 | Gene: | SPAC1A6.02 / 3361484 | PomBaseID: | SPAC1A6.02 | Length: | 361 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 259 | Identity: | 52/259 - (20%) |
---|---|---|---|
Similarity: | 81/259 - (31%) | Gaps: | 82/259 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 162 GDIQHTHLVKGLDYALLQKVRSELHSKEAEEEEIAAAVAREKLAEAAAAAEQLEAERRESEDINA 226
Fly 227 INGALARNIYNLVQARRSKEVPRNELFAPGRMAYVIDLDDELGESDIPTTLKRSKFEVPVSQED- 290
Fly 291 -VATLTTND-----------------IVINKLSQILSYLRAGGRNKKNKKRD------------- 324
Fly 325 ---KDKPLFYEKEVENLRGSSSNGGSSRHATSSSS------------NMGGKSAPLGDNIYDDI 373 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
beag | NP_649865.1 | RED_N | 87..315 | CDD:285099 | 35/171 (20%) |
RED_C | 434..539 | CDD:285098 | |||
SPAC1A6.02 | NP_001342873.1 | WD40 | 5..>314 | CDD:225201 | 37/208 (18%) |
WD40 repeat | 17..54 | CDD:293791 | |||
WD40 repeat | 64..99 | CDD:293791 | |||
WD40 repeat | 109..146 | CDD:293791 | 5/8 (63%) | ||
WD40 repeat | 151..185 | CDD:293791 | 5/33 (15%) | ||
WD40 repeat | 193..239 | CDD:293791 | 13/62 (21%) | ||
WD40 repeat | 242..278 | CDD:293791 | 7/41 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1814 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |