DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beag and SPAC1A6.02

DIOPT Version :9

Sequence 1:NP_649865.1 Gene:beag / 41091 FlyBaseID:FBgn0037660 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001342873.1 Gene:SPAC1A6.02 / 3361484 PomBaseID:SPAC1A6.02 Length:361 Species:Schizosaccharomyces pombe


Alignment Length:259 Identity:52/259 - (20%)
Similarity:81/259 - (31%) Gaps:82/259 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GDIQHTHLVKGLDYALLQKVRSELHSKEAEEEEIAAAVAREKLAEAAAAAEQLEAERRESEDINA 226
            |.|.||| ...:||         :.|....||....|.:.:.:.....|....:....|.:|...
pombe   138 GGIIHTH-NDHIDY---------ISSISPFEERYFVATSGDGVLSVIDARNFKKPILSEEQDEEM 192

  Fly   227 INGALARNIYNLVQARRSKEVPRNELFAPGRMAYVIDLDDELGESDIPTTLKRSKFEVPVSQED- 290
            ..||..|:       :.||     :.||.|..:.||.|..:....|     ...:...|:...| 
pombe   193 TCGAFTRD-------QHSK-----KKFAVGTASGVITLFTKGDWGD-----HTDRILSPIRSHDF 240

  Fly   291 -VATLTTND-----------------IVINKLSQILSYLRAGGRNKKNKKRD------------- 324
             :.|:|..|                 |:.||..:|:      |::......|             
pombe   241 SIETITRADSDSLYVGGSDGCIRLLHILPNKYERII------GQHSSRSTVDAVDVTTEGNFLVS 299

  Fly   325 ---KDKPLFYEKEVENLRGSSSNGGSSRHATSSSS------------NMGGKSAPLGDNIYDDI 373
               .:...:...:.|....|||:...|...:||.|            |.|.|  |||.:.:|.:
pombe   300 CSGTELAFWPVDQKEGDESSSSDNLDSDEDSSSDSEFSSPKKKKKVGNQGKK--PLGTDFFDGL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beagNP_649865.1 RED_N 87..315 CDD:285099 35/171 (20%)
RED_C 434..539 CDD:285098
SPAC1A6.02NP_001342873.1 WD40 5..>314 CDD:225201 37/208 (18%)
WD40 repeat 17..54 CDD:293791
WD40 repeat 64..99 CDD:293791
WD40 repeat 109..146 CDD:293791 5/8 (63%)
WD40 repeat 151..185 CDD:293791 5/33 (15%)
WD40 repeat 193..239 CDD:293791 13/62 (21%)
WD40 repeat 242..278 CDD:293791 7/41 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1814
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.