| Sequence 1: | NP_649865.1 | Gene: | beag / 41091 | FlyBaseID: | FBgn0037660 | Length: | 557 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001017932.1 | Gene: | Wdr55 / 307494 | RGDID: | 1305640 | Length: | 384 | Species: | Rattus norvegicus |
| Alignment Length: | 237 | Identity: | 50/237 - (21%) |
|---|---|---|---|
| Similarity: | 88/237 - (37%) | Gaps: | 68/237 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 91 QEDVKLQELSEKYRDRARERRDGANPDYVNVSTPGHGSSTNAYR--AVAPDMKSGI-----DAQE 148
Fly 149 RRRRIIQESKFLGGDIQHTHLVKGLDYALLQKVRSELHSKEAEEEEIAAAVAREKLAEAAAAAEQ 213
Fly 214 LEAERRESEDINA-INGALARNIYNLVQA---------RRSKEVPRNELFAPGRMAYVIDL---- 264
Fly 265 ----------DDELGESDIPTTLKRSKFEVPVSQEDVATLTT 296 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| beag | NP_649865.1 | RED_N | 87..315 | CDD:285099 | 50/237 (21%) |
| RED_C | 434..539 | CDD:285098 | |||
| Wdr55 | NP_001017932.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | 4/25 (16%) | |
| WD 1 | 36..75 | 8/44 (18%) | |||
| WD40 | <42..337 | CDD:225201 | 44/202 (22%) | ||
| WD40 repeat | 42..81 | CDD:293791 | 9/44 (20%) | ||
| WD 2 | 82..121 | 10/53 (19%) | |||
| WD40 | 83..330 | CDD:295369 | 35/155 (23%) | ||
| WD40 repeat | 88..125 | CDD:293791 | 11/40 (28%) | ||
| WD 3 | 125..163 | 9/37 (24%) | |||
| WD40 repeat | 130..165 | CDD:293791 | 8/36 (22%) | ||
| WD 4 | 166..205 | 10/43 (23%) | |||
| WD40 repeat | 172..206 | CDD:293791 | 9/38 (24%) | ||
| WD 5 | 208..247 | 2/8 (25%) | |||
| WD40 repeat | 213..250 | CDD:293791 | 2/3 (67%) | ||
| WD 6 | 250..289 | ||||
| WD40 repeat | 258..295 | CDD:293791 | |||
| WD 7 | 293..332 | ||||
| WD40 repeat | 302..322 | CDD:293791 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 362..384 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||