DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and JHD1

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_010971.1 Gene:JHD1 / 856777 SGDID:S000000853 Length:492 Species:Saccharomyces cerevisiae


Alignment Length:270 Identity:109/270 - (40%)
Similarity:149/270 - (55%) Gaps:14/270 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NIPLLFRDKAGLGLRMP----DPQEFTVNDVRLCVGSRRLLDVMDVNTQKNLQMTMKEWQQYY-- 164
            ::|....|....|:.:|    |....|||.:...:|....:|||||.:|.|....:..|.:|:  
Yeast   161 DVPYKIIDPLNSGVYVPNVGTDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTN 225

  Fly   165 -DSPQKDRLLNVISLEFSH---TRLDRFVQSPEIVRQIDWVDVVWPKQLKDAQREGTNLLGGMMY 225
             :..::||:.||||||.|:   ..|:|    |..|||.|.||.:|.......:..|.........
Yeast   226 TEPDRRDRIRNVISLEVSNIEGLELER----PTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPK 286

  Fly   226 PKVQKYCLMSVKNCYTDFHIDFGGTSVWYHILRGSKVFWLIPPTDRNLQLYEKWVLSGKQADIFF 290
            |||.||.|||||:.|||||:||.||||:|:::.|.|.|.|.|||..|:..|.:|.|...|..:|.
Yeast   287 PKVTKYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFL 351

  Fly   291 GDTVEKCARVYLTAGNTFFIPTGWIHAVYTPTQSLVFGGNFLHSFGIVKQLKTASVEDSTKVPQK 355
            ||.:|....:.|.||:.|.||.|:|||||||..|||||||||....:...||...:|..||||::
Yeast   352 GDILEDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRR 416

  Fly   356 FRYPFFTEML 365
            |.:|.|.:::
Yeast   417 FTFPKFDQVM 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367 54/99 (55%)
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689
leucine-rich repeat 1102..1125 CDD:275381
leucine-rich repeat 1126..1149 CDD:275381
leucine-rich repeat 1150..1173 CDD:275381
AMN1 1166..>1320 CDD:187754
leucine-rich repeat 1174..1213 CDD:275381
leucine-rich repeat 1214..1238 CDD:275381
leucine-rich repeat 1239..1267 CDD:275381
leucine-rich repeat 1268..1292 CDD:275381
leucine-rich repeat 1293..1317 CDD:275381
JHD1NP_010971.1 PHD 6..69 CDD:214584
JmjC <278..320 CDD:214721 22/41 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3167
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000253
OrthoInspector 1 1.000 - - oto99414
orthoMCL 1 0.900 - - OOG6_104082
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R626
SonicParanoid 1 1.000 - - X1005
TreeFam 00.000 Not matched by this tool.
98.620

Return to query results.
Submit another query.