DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and fbxl16

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_001188265.1 Gene:fbxl16 / 797939 ZFINID:ZDB-GENE-120215-180 Length:493 Species:Danio rerio


Alignment Length:304 Identity:73/304 - (24%)
Similarity:116/304 - (38%) Gaps:53/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1061 QNLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEHKMSASLLTAIVRRQP 1125
            :.|.||..||..:..|...........|||.|......|..|:.:....|  :..|.|.:...:.
Zfish   107 RQLILDEKVLNRLLWYFTTAEKCILAQVCKTWRKVLYQPKFWEGVTPILH--AKELYTILPNGEK 169

  Fly  1126 EHLILDWTQIAKRQLAWLVA-----------RLP----ALKNLSLQNCPI-QAVLALHTCLCPPL 1174
            |.:.|....:...|...||.           ..|    .:|::||:...| .|.|.:.......|
Zfish   170 EFVSLQAFALRGFQAFCLVGVSDLDICEFIDNYPLSKKGVKSVSLKRSTITDAGLEVMLEQMQGL 234

  Fly  1175 QTLDLSFVRGLND----------------AAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAGTD 1223
            ..|:||   |.||                .::.|.::...|:...:|.   .|.:|..:.|....
Zfish   235 MHLELS---GCNDFTEAGLWSSLNARLTSLSVSDCINVADDAIAAISQ---LLPNLSELSLQAYH 293

  Fly  1224 ISDVAVRYITQSLPYLRH-LDLSSCQRITDAGVAQIGTSTTATARLTELNLSACRLVSENALEHL 1287
            ::|.|:.|.|....|..| |.|:||..||:.||..:   ..:...||.|:||.|..::::.:|.:
Zfish   294 VTDTAMAYFTAKQGYTTHTLRLNSCWEITNHGVVNM---VHSLPNLTSLSLSGCSKITDDGVELV 355

  Fly  1288 AK-CEGLIWLDLRHVPQVSTQSVIRFASNSKH-------DLCVR 1323
            |: ...|..|||...|:: |...:.:.:...|       |.|||
Zfish   356 AENLRKLRSLDLSWCPRI-TDMALEYIACDLHKLEELVLDRCVR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 7/34 (21%)
leucine-rich repeat 1102..1125 CDD:275381 4/22 (18%)
leucine-rich repeat 1126..1149 CDD:275381 6/37 (16%)
leucine-rich repeat 1150..1173 CDD:275381 6/23 (26%)
AMN1 1166..>1320 CDD:187754 42/178 (24%)
leucine-rich repeat 1174..1213 CDD:275381 11/54 (20%)
leucine-rich repeat 1214..1238 CDD:275381 6/23 (26%)
leucine-rich repeat 1239..1267 CDD:275381 9/28 (32%)
leucine-rich repeat 1268..1292 CDD:275381 8/24 (33%)
leucine-rich repeat 1293..1317 CDD:275381 6/23 (26%)
fbxl16NP_001188265.1 leucine-rich repeat 209..233 CDD:275381 6/23 (26%)
AMN1 215..446 CDD:187754 49/194 (25%)
leucine-rich repeat 234..253 CDD:275381 7/21 (33%)
leucine-rich repeat 258..283 CDD:275381 4/27 (15%)
leucine-rich repeat 284..308 CDD:275381 6/23 (26%)
leucine-rich repeat 309..335 CDD:275381 9/28 (32%)
leucine-rich repeat 336..361 CDD:275381 8/24 (33%)
leucine-rich repeat 362..387 CDD:275381 6/25 (24%)
leucine-rich repeat 388..412 CDD:275381 4/11 (36%)
leucine-rich repeat 413..437 CDD:275381
leucine-rich repeat 438..457 CDD:275381
leucine-rich repeat 463..488 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.