Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001335097.5 | Gene: | fbxl17 / 795023 | ZFINID: | ZDB-GENE-111013-3 | Length: | 409 | Species: | Danio rerio |
Alignment Length: | 269 | Identity: | 62/269 - (23%) |
---|---|---|---|
Similarity: | 105/269 - (39%) | Gaps: | 44/269 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1005 SSSSGNGGSASATNGISNG--SNQSGANSCG---------AGNGERGTNNGGLSGSNGLGNQHYS 1058
Fly 1059 SSQNLALDPTVLKIIFRYLP-QDTLVTCCSVCKVWSNAAVDPDLWKKMNCSE-HKMSASLLTAIV 1121
Fly 1122 -RRQ--PEHLILDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALHTCL--CPPLQTLDLSF 1181
Fly 1182 VRGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAGTDISDVAVRYITQSLPYLRHLDLSS 1246
Fly 1247 CQRITDAGV 1255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 9/35 (26%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 9/26 (35%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 4/22 (18%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 5/24 (21%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 20/92 (22%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 8/38 (21%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 4/23 (17%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 3/17 (18%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | |||
leucine-rich repeat | 1293..1317 | CDD:275381 | |||
fbxl17 | XP_001335097.5 | F-box-like | 221..268 | CDD:289689 | 12/59 (20%) |
AMN1 | 257..>397 | CDD:187754 | 34/152 (22%) | ||
leucine-rich repeat | 262..287 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 288..313 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 314..339 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 340..365 | CDD:275381 | 7/35 (20%) | ||
leucine-rich repeat | 366..391 | CDD:275381 | 6/26 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |