| Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_780415.1 | Gene: | Fbxl22 / 74165 | MGIID: | 1921415 | Length: | 236 | Species: | Mus musculus |
| Alignment Length: | 241 | Identity: | 56/241 - (23%) |
|---|---|---|---|
| Similarity: | 92/241 - (38%) | Gaps: | 64/241 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1065 LDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEHKMSASLLTAIVRRQPEHLI 1129
Fly 1130 LDWTQIAKRQLAWLVARL-PALKNLSL-------QNCPIQAVL--ALHTCLCPPLQTLDLSFVRG 1184
Fly 1185 LNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAGT-DISDVAVRYITQSLPYLRHLDLSSCQ 1248
Fly 1249 RITDAGVAQIGTSTTATARLTELNLSACRLVSENALEHL-AKCEGL 1293 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
| PRTases_typeI | <394..>467 | CDD:294217 | |||
| zf-CXXC | 670..716 | CDD:251032 | |||
| PHD_4 | 721..801 | CDD:293471 | |||
| F-box-like | <1073..1108 | CDD:289689 | 8/34 (24%) | ||
| leucine-rich repeat | 1102..1125 | CDD:275381 | 2/22 (9%) | ||
| leucine-rich repeat | 1126..1149 | CDD:275381 | 3/23 (13%) | ||
| leucine-rich repeat | 1150..1173 | CDD:275381 | 10/31 (32%) | ||
| AMN1 | 1166..>1320 | CDD:187754 | 32/130 (25%) | ||
| leucine-rich repeat | 1174..1213 | CDD:275381 | 5/38 (13%) | ||
| leucine-rich repeat | 1214..1238 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 1239..1267 | CDD:275381 | 9/27 (33%) | ||
| leucine-rich repeat | 1268..1292 | CDD:275381 | 10/24 (42%) | ||
| leucine-rich repeat | 1293..1317 | CDD:275381 | 1/1 (100%) | ||
| Fbxl22 | NP_780415.1 | F-box-like | 3..43 | CDD:403981 | 8/36 (22%) |
| LRR 1 | 15..40 | 4/24 (17%) | |||
| LRR 2 | 43..72 | 10/55 (18%) | |||
| AMN1 | 45..>200 | CDD:187754 | 46/202 (23%) | ||
| LRR 3 | 98..123 | 6/46 (13%) | |||
| leucine-rich repeat | 116..141 | CDD:275381 | 5/34 (15%) | ||
| LRR 4 | 124..149 | 7/24 (29%) | |||
| leucine-rich repeat | 142..167 | CDD:275381 | 8/24 (33%) | ||
| LRR 5 | 150..175 | 7/27 (26%) | |||
| leucine-rich repeat | 168..193 | CDD:275381 | 10/24 (42%) | ||
| LRR 6 | 176..201 | 9/19 (47%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||