DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and Fbxl15

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_001365702.1 Gene:Fbxl15 / 68431 MGIID:1915681 Length:336 Species:Mus musculus


Alignment Length:189 Identity:56/189 - (29%)
Similarity:85/189 - (44%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1107 CSEHKMSASLLTAIVRRQPE---HLILDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALHT 1168
            |.|. :|...|..::.|.|:   ..:....|:::|.|..|....|.|:.|||.:|.....|||..
Mouse   133 CHEW-LSDEDLVPVLARNPQ
LRSVALAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRG 196

  Fly  1169 CL--CPPLQTLDLSFVRGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLA-GTDISDVAVR 1230
            ..  ||.|:.|||:..|.|.|.||..:             ::.|...|:.:.|| ..::.|.||:
Mouse   197 LADRCPALEELDLTACRQLKDEAIVYL-------------AQRRGAGLRSLSLAVNANVGDTAVQ 248

  Fly  1231 YITQSLPYLRHLDLSSCQRITDAGVAQIGTSTTATARLTELNLSACRLVSENALEHLAK 1289
            .:.::.|.|.||||:.|.|:...||..:.....|   |..|.:..|..|:|.:|..|.|
Mouse   249 ELARNCPQLEHLDLTGCLRVGSDGVRTLAEYCPA---LRSLRVRHCHHVAEPSLSRLRK 304

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471