Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001347270.1 | Gene: | Fbxl3 / 50789 | MGIID: | 1354702 | Length: | 428 | Species: | Mus musculus |
Alignment Length: | 274 | Identity: | 61/274 - (22%) |
---|---|---|---|
Similarity: | 107/274 - (39%) | Gaps: | 53/274 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1062 NLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEHKMSASLLTAIVRRQPE 1126
Fly 1127 HLILDWTQIAKR---QLAWLVARLPALKNLSLQNCPIQAVLALHTCLCPPLQTLDLSFVRGLNDA 1188
Fly 1189 AIRDILSPPKDS-RPGLSDSKTRLRDLKVMKLAGTDISDVAVR-YITQSLPYLRHLDLSSCQRIT 1251
Fly 1252 DAGV-----------------------AQIGTSTTATARLTELNLSACRLVSEN-ALEHLAKCEG 1292
Fly 1293 LIW-LDLRHVPQVS 1305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 11/34 (32%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 3/22 (14%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 5/22 (23%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 34/167 (20%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 9/39 (23%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 8/50 (16%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 1293..1317 | CDD:275381 | 4/14 (29%) | ||
Fbxl3 | NP_001347270.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | ||
F-box-like | 36..77 | CDD:315592 | 13/40 (33%) | ||
LRR 1 | 119..146 | 10/37 (27%) | |||
leucine-rich repeat | 174..199 | CDD:275381 | 4/24 (17%) | ||
LRR 2 | 181..207 | 4/25 (16%) | |||
leucine-rich repeat | 200..225 | CDD:275381 | 7/24 (29%) | ||
LRR 3 | 208..233 | 3/24 (13%) | |||
LRR 4 | 234..259 | 4/27 (15%) | |||
leucine-rich repeat | 252..286 | CDD:275381 | 9/36 (25%) | ||
leucine-rich repeat | 287..333 | CDD:275381 | 1/2 (50%) | ||
LRR 5 | 316..341 | ||||
leucine-rich repeat | 334..360 | CDD:275381 | |||
LRR 6 | 343..368 | ||||
leucine-rich repeat | 361..383 | CDD:275381 | |||
LRR 7 | 369..394 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |