DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and FipoQ

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:374 Identity:71/374 - (18%)
Similarity:124/374 - (33%) Gaps:120/374 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1049 SNGLGNQHYSSSQNLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSE---- 1109
            |:|.....::.:....|...||..||.||....:.....:|:.|...|.|..|||.::...    
  Fly    21 SDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSG 85

  Fly  1110 -HKMSASLLTAI--VRRQP--EHLILDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALH-- 1167
             |..|..:|..:  ||..|  .::.|....|....|..|.|:.|.|.::.|.   ....:.||  
  Fly    86 LHVGSLEMLLQLISVRFGPTLRYIELPIELITHTVLHELSAKCPNLTHMLLD---FSTAMQLHDF 147

  Fly  1168 ------------TCLCPPLQTLDLS--------------FVRGL--------------NDAAIRD 1192
                        .|:|       ||              |:.||              .:..|.:
  Fly   148 SEMQAFPTKLRYMCVC-------LSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYE 205

  Fly  1193 ILSPPKDSRPGLSDSKTRLRDLKVMKLAGTD-ISDVAVRYITQSLPYLRHLDLSSCQRITDAGVA 1256
            :::..|        .|:...:|:|:.|.|.: |.|..:...:.:...|..|.::.|.::|.:.:.
  Fly   206 VINVHK--------LKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLK 262

  Fly  1257 QI-------------GTSTTA---------TARLTELNLSACRLVSENALEHLAK---------- 1289
            .:             |||..:         ...|.||:::|..|.:|..::.|::          
  Fly   263 TLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAG 327

  Fly  1290 ------------------CEGLIWLDLRHVPQVSTQSVIRFASNSKHDL 1320
                              ...||.|||.....:|.:.:::|.....|.|
  Fly   328 QINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 11/34 (32%)
leucine-rich repeat 1102..1125 CDD:275381 7/29 (24%)
leucine-rich repeat 1126..1149 CDD:275381 5/22 (23%)
leucine-rich repeat 1150..1173 CDD:275381 6/36 (17%)
AMN1 1166..>1320 CDD:187754 40/246 (16%)
leucine-rich repeat 1174..1213 CDD:275381 8/66 (12%)
leucine-rich repeat 1214..1238 CDD:275381 6/24 (25%)
leucine-rich repeat 1239..1267 CDD:275381 7/49 (14%)
leucine-rich repeat 1268..1292 CDD:275381 7/51 (14%)
leucine-rich repeat 1293..1317 CDD:275381 7/23 (30%)
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 14/45 (31%)
leucine-rich repeat 131..156 CDD:275381 4/27 (15%)
leucine-rich repeat 157..175 CDD:275381 4/24 (17%)
leucine-rich repeat 219..244 CDD:275381 6/24 (25%)
leucine-rich repeat 245..270 CDD:275381 4/24 (17%)
leucine-rich repeat 271..295 CDD:275381 3/23 (13%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 0/26 (0%)
leucine-rich repeat 349..375 CDD:275381 7/25 (28%)
leucine-rich repeat 376..403 CDD:275381 1/1 (100%)
leucine-rich repeat 405..432 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.