Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_733291.1 | Gene: | FipoQ / 43475 | FlyBaseID: | FBgn0039667 | Length: | 515 | Species: | Drosophila melanogaster |
Alignment Length: | 374 | Identity: | 71/374 - (18%) |
---|---|---|---|
Similarity: | 124/374 - (33%) | Gaps: | 120/374 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1049 SNGLGNQHYSSSQNLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSE---- 1109
Fly 1110 -HKMSASLLTAI--VRRQP--EHLILDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALH-- 1167
Fly 1168 ------------TCLCPPLQTLDLS--------------FVRGL--------------NDAAIRD 1192
Fly 1193 ILSPPKDSRPGLSDSKTRLRDLKVMKLAGTD-ISDVAVRYITQSLPYLRHLDLSSCQRITDAGVA 1256
Fly 1257 QI-------------GTSTTA---------TARLTELNLSACRLVSENALEHLAK---------- 1289
Fly 1290 ------------------CEGLIWLDLRHVPQVSTQSVIRFASNSKHDL 1320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 11/34 (32%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 7/29 (24%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 5/22 (23%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 6/36 (17%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 40/246 (16%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 8/66 (12%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 7/49 (14%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | 7/51 (14%) | ||
leucine-rich repeat | 1293..1317 | CDD:275381 | 7/23 (30%) | ||
FipoQ | NP_733291.1 | F-box-like | 34..80 | CDD:289689 | 14/45 (31%) |
leucine-rich repeat | 131..156 | CDD:275381 | 4/27 (15%) | ||
leucine-rich repeat | 157..175 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 219..244 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 245..270 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 271..295 | CDD:275381 | 3/23 (13%) | ||
leucine-rich repeat | 296..320 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 321..348 | CDD:275381 | 0/26 (0%) | ||
leucine-rich repeat | 349..375 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 376..403 | CDD:275381 | 1/1 (100%) | ||
leucine-rich repeat | 405..432 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |