DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and CG12402

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster


Alignment Length:253 Identity:59/253 - (23%)
Similarity:99/253 - (39%) Gaps:54/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1126 EHLILDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALHTCLC---PPLQTLDLSFVRGLND 1187
            |.:.||     :..:..|:.|||.|:.|||.||...........:|   ..|:.|::.:...:.|
  Fly   419 ETIFLD-----ESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITD 478

  Fly  1188 AAIRDILSPPKDSRPGLSDSK---TRLRDLKVMKLAG----TDIS-----------DVAVRY--- 1231
            ..:.           |..|:.   :|||.||.:.|.|    ||.|           .:::.|   
  Fly   479 QGLM-----------GYGDTPYPISRLRGLKELNLRGCRNVTDSSLMVGLKLPELRALSLGYCNR 532

  Fly  1232 --------ITQSLPYLRHLDLSSCQRITDAGVAQIGTSTTATARLTELNLSACRLVSENALEH-L 1287
                    :||:.|.|..|.:|||..:.|..|..|   .:...||..||||.|..::..::.| |
  Fly   533 LTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNI---VSNLKRLRVLNLSNCTKLTLQSIHHIL 594

  Fly  1288 AKCEGLIWLDLRHVPQVSTQSVIRFASNSKHDLCVRDIKLVERRRRNSTTANRSWHHD 1345
            |....|:.|....:..:..:...|...:.:..:  :.:.|.:.|..:..:.|...|:|
  Fly   595 AHGHNLVQLIACSIDGMDHEQAQRILESQRPQM--KQVLLXQERYIHXRSRNTPHHND 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689
leucine-rich repeat 1102..1125 CDD:275381
leucine-rich repeat 1126..1149 CDD:275381 6/22 (27%)
leucine-rich repeat 1150..1173 CDD:275381 7/25 (28%)
AMN1 1166..>1320 CDD:187754 41/186 (22%)
leucine-rich repeat 1174..1213 CDD:275381 7/41 (17%)
leucine-rich repeat 1214..1238 CDD:275381 10/49 (20%)
leucine-rich repeat 1239..1267 CDD:275381 8/27 (30%)
leucine-rich repeat 1268..1292 CDD:275381 9/24 (38%)
leucine-rich repeat 1293..1317 CDD:275381 3/23 (13%)
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 17/67 (25%)
leucine-rich repeat 304..330 CDD:275381
leucine-rich repeat 331..357 CDD:275381
leucine-rich repeat 358..379 CDD:275381
leucine-rich repeat 384..409 CDD:275381
leucine-rich repeat 412..437 CDD:275381 6/22 (27%)
AMN1 430..595 CDD:187754 46/178 (26%)
leucine-rich repeat 438..464 CDD:275381 7/25 (28%)
leucine-rich repeat 465..496 CDD:275381 7/41 (17%)
leucine-rich repeat 497..521 CDD:275381 7/23 (30%)
leucine-rich repeat 522..547 CDD:275381 3/24 (13%)
leucine-rich repeat 548..573 CDD:275381 8/27 (30%)
leucine-rich repeat 574..599 CDD:275381 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.