DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and CG8272

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster


Alignment Length:299 Identity:61/299 - (20%)
Similarity:105/299 - (35%) Gaps:114/299 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1106 NCSEHKMSASLLTAIVRRQP---EHLILDWTQIAKRQLAWLVARLPALKNLSLQNC-------PI 1160
            || ::..|:.::..|...:.   :.|.:.:.||.:..:..:.:.|..|::|.|.:|       .|
  Fly   354 NC-DNLTSSGIIEGIASEENPVIQELNVSYLQICEECIKAIASNLRCLRSLHLNHCVNGATDEAI 417

  Fly  1161 QAVLALHTCLCPPLQTLDLSFVRGLNDAAI---------------------RDILSPP------- 1197
            |:|:.....    |:.|.|....||.|||:                     .|...||       
  Fly   418 QSVIGQLRW----LRELSLEHCSGLTDAALTGINISKLEMSRKQSGSQVSSMDNFYPPYSNTLAE 478

  Fly  1198 KDSRPG-----------------LSDSKTR------------------------LRDLKVMKLAG 1221
            :||..|                 :.|::.:                        ||.|:.:.|.|
  Fly   479 RDSLAGSLQSIKISLRSKAEDEIVRDARRKQAMLAAYEMNLIREDDFEGHNIQQLRGLRSLNLRG 543

  Fly  1222 TD-ISDVAVRY-------------------------ITQSLPYLRHLDLSSCQRITDAGVAQIGT 1260
            .: ||||:::|                         :..|.|.:..||||.|..|||..:..:  
  Fly   544 CNKISDVSLKYGLKHIELRRLMLSNCQQISLLGMEAMASSCPSIEELDLSDCYNITDKTIQVV-- 606

  Fly  1261 STTATARLTELNLSACRLVSENALEH-LAKCEGLIWLDL 1298
             |:...||..|::|.|..::|:.|:. :..|..|..|.:
  Fly   607 -TSKLPRLKALHISGCSQLTEHTLDAIITNCSCLQTLSI 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 1/1 (100%)
leucine-rich repeat 1102..1125 CDD:275381 4/18 (22%)
leucine-rich repeat 1126..1149 CDD:275381 4/22 (18%)
leucine-rich repeat 1150..1173 CDD:275381 7/29 (24%)
AMN1 1166..>1320 CDD:187754 46/229 (20%)
leucine-rich repeat 1174..1213 CDD:275381 16/107 (15%)
leucine-rich repeat 1214..1238 CDD:275381 9/49 (18%)
leucine-rich repeat 1239..1267 CDD:275381 9/27 (33%)
leucine-rich repeat 1268..1292 CDD:275381 7/24 (29%)
leucine-rich repeat 1293..1317 CDD:275381 2/6 (33%)
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 20/90 (22%)
leucine-rich repeat 270..295 CDD:275381
leucine-rich repeat 296..319 CDD:275381
leucine-rich repeat 322..346 CDD:275381
leucine-rich repeat 347..399 CDD:275381 8/45 (18%)
leucine-rich repeat 400..426 CDD:275381 7/25 (28%)
leucine-rich repeat 427..535 CDD:275381 16/107 (15%)
AMN1 515..>642 CDD:187754 30/129 (23%)
leucine-rich repeat 536..560 CDD:275381 8/23 (35%)
leucine-rich repeat 561..586 CDD:275381 1/24 (4%)
leucine-rich repeat 587..612 CDD:275381 9/27 (33%)
leucine-rich repeat 613..638 CDD:275381 7/24 (29%)
leucine-rich repeat 639..663 CDD:275381 2/6 (33%)
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381
leucine-rich repeat 167..192 CDD:275381
leucine-rich repeat 193..244 CDD:275381
C2 <231..274 CDD:301316
leucine-rich repeat 246..269 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.